Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4107780..4108356 | Replicon | chromosome |
Accession | NZ_CP103710 | ||
Organism | Escherichia coli O25b:H4-ST131 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | A0A061KXE4 |
Locus tag | M5S69_RS20315 | Protein ID | WP_001295743.1 |
Coordinates | 4108069..4108356 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A066STF6 |
Locus tag | M5S69_RS20310 | Protein ID | WP_000063148.1 |
Coordinates | 4107780..4108082 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S69_RS20295 (4104376) | 4104376..4106526 | + | 2151 | WP_001295524.1 | pyruvate/proton symporter BtsT | - |
M5S69_RS20300 (4106576) | 4106576..4106779 | + | 204 | WP_000467859.1 | YbdD/YjiX family protein | - |
M5S69_RS20305 (4106790) | 4106790..4107746 | + | 957 | WP_001295745.1 | GTPase | - |
M5S69_RS20310 (4107780) | 4107780..4108082 | - | 303 | WP_000063148.1 | BrnA antitoxin family protein | Antitoxin |
M5S69_RS20315 (4108069) | 4108069..4108356 | - | 288 | WP_001295743.1 | BrnT family toxin | Toxin |
M5S69_RS20320 (4108553) | 4108553..4109719 | + | 1167 | WP_000800831.1 | restriction endonuclease | - |
M5S69_RS20325 (4109783) | 4109783..4111402 | + | 1620 | WP_001029745.1 | class I SAM-dependent DNA methyltransferase | - |
M5S69_RS20330 (4111392) | 4111392..4112696 | + | 1305 | WP_000535012.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11156.62 Da Isoelectric Point: 7.4697
>T256289 WP_001295743.1 NZ_CP103710:c4108356-4108069 [Escherichia coli O25b:H4-ST131]
MPMEFEWDANKAKSNRVKHGIRFEDAVLVFDDPQHLSQQDRIENGEYRWQTIGLVHGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERSRYEHG
MPMEFEWDANKAKSNRVKHGIRFEDAVLVFDDPQHLSQQDRIENGEYRWQTIGLVHGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERSRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061KXE4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A066STF6 |