Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3545957..3546575 | Replicon | chromosome |
| Accession | NZ_CP103710 | ||
| Organism | Escherichia coli O25b:H4-ST131 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | M5S69_RS17600 | Protein ID | WP_001291435.1 |
| Coordinates | 3546357..3546575 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | M5S69_RS17595 | Protein ID | WP_000344800.1 |
| Coordinates | 3545957..3546331 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S69_RS17585 (3541046) | 3541046..3542239 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M5S69_RS17590 (3542262) | 3542262..3545411 | + | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
| M5S69_RS17595 (3545957) | 3545957..3546331 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| M5S69_RS17600 (3546357) | 3546357..3546575 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| M5S69_RS17605 (3546749) | 3546749..3547300 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| M5S69_RS17610 (3547416) | 3547416..3547886 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| M5S69_RS17615 (3548050) | 3548050..3549600 | + | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| M5S69_RS17620 (3549642) | 3549642..3549995 | - | 354 | WP_000878135.1 | DUF1428 family protein | - |
| M5S69_RS17630 (3550374) | 3550374..3550685 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| M5S69_RS17635 (3550716) | 3550716..3551288 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T256287 WP_001291435.1 NZ_CP103710:3546357-3546575 [Escherichia coli O25b:H4-ST131]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT256287 WP_000344800.1 NZ_CP103710:3545957-3546331 [Escherichia coli O25b:H4-ST131]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |