Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 19349..19950 Replicon plasmid pMB3362_2
Accession NZ_CP103706
Organism Escherichia coli strain ST361

Toxin (Protein)


Gene name doc Uniprot ID U9YA20
Locus tag M5T41_RS24360 Protein ID WP_001216045.1
Coordinates 19349..19729 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag M5T41_RS24365 Protein ID WP_001190712.1
Coordinates 19729..19950 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T41_RS24335 (M5T41_24335) 14789..16231 - 1443 WP_223656860.1 terminase -
M5T41_RS24340 (M5T41_24340) 16273..17466 - 1194 WP_000219604.1 terminase -
M5T41_RS24345 (M5T41_24345) 17553..18005 - 453 WP_001312282.1 late promoter-activating protein (Gp10) -
M5T41_RS24350 (M5T41_24350) 18094..19137 - 1044 WP_044169711.1 DUF968 domain-containing protein -
M5T41_RS24355 (M5T41_24355) 19165..19344 - 180 WP_000113019.1 hypothetical protein -
M5T41_RS24360 (M5T41_24360) 19349..19729 - 381 WP_001216045.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M5T41_RS24365 (M5T41_24365) 19729..19950 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M5T41_RS24370 (M5T41_24370) 20023..20412 - 390 WP_046660029.1 S24 family peptidase -
M5T41_RS24375 (M5T41_24375) 20587..20826 + 240 WP_226438661.1 hypothetical protein -
M5T41_RS24380 (M5T41_24380) 20804..21178 + 375 Protein_29 integrase core domain-containing protein -
M5T41_RS24385 (M5T41_24385) 21749..23605 - 1857 WP_112014851.1 acyltransferase family protein -
M5T41_RS24390 (M5T41_24390) 23831..24577 + 747 Protein_31 IS1 family transposase -
M5T41_RS24395 (M5T41_24395) 24676..24855 - 180 Protein_32 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid sul2 / aph(3'')-Ib / aph(6)-Id - 1..109870 109870


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13588.29 Da        Isoelectric Point: 5.1514

>T256274 WP_001216045.1 NZ_CP103706:c19729-19349 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT256274 WP_001190712.1 NZ_CP103706:c19950-19729 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CLP7

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References