Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4227059..4227654 | Replicon | chromosome |
Accession | NZ_CP103704 | ||
Organism | Escherichia coli strain ST361 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9Y4M4 |
Locus tag | M5T41_RS20530 | Protein ID | WP_000239579.1 |
Coordinates | 4227059..4227409 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | M5T41_RS20535 | Protein ID | WP_001223208.1 |
Coordinates | 4227403..4227654 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T41_RS20510 (4222508) | 4222508..4223530 | - | 1023 | WP_001353963.1 | ABC transporter permease | - |
M5T41_RS20515 (4223544) | 4223544..4225046 | - | 1503 | WP_000210557.1 | sugar ABC transporter ATP-binding protein | - |
M5T41_RS20520 (4225186) | 4225186..4226142 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
M5T41_RS20525 (4226452) | 4226452..4226982 | + | 531 | WP_000055072.1 | inorganic diphosphatase | - |
M5T41_RS20530 (4227059) | 4227059..4227409 | - | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
M5T41_RS20535 (4227403) | 4227403..4227654 | - | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
M5T41_RS20540 (4227866) | 4227866..4228207 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
M5T41_RS20545 (4228210) | 4228210..4231989 | - | 3780 | WP_259419487.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T256265 WP_000239579.1 NZ_CP103704:c4227409-4227059 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LQ26 |