Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2864001..2864845 Replicon chromosome
Accession NZ_CP103704
Organism Escherichia coli strain ST361

Toxin (Protein)


Gene name yeeV Uniprot ID B1LJY4
Locus tag M5T41_RS13990 Protein ID WP_000854686.1
Coordinates 2864001..2864384 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A8E0J1S3
Locus tag M5T41_RS13995 Protein ID WP_001285602.1
Coordinates 2864465..2864845 (-) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T41_RS13950 (2859003) 2859003..2859494 - 492 WP_001300785.1 DUF1097 domain-containing protein -
M5T41_RS13955 (2859596) 2859596..2860150 - 555 WP_001001921.1 molecular chaperone YcdY -
M5T41_RS13960 (2860174) 2860174..2860911 - 738 WP_000283667.1 zinc-binding phosphatase -
M5T41_RS13965 (2860966) 2860966..2861904 - 939 WP_000351317.1 glyoxylate/hydroxypyruvate reductase GhrA -
M5T41_RS13975 (2862375) 2862375..2863217 - 843 WP_001431817.1 DUF4942 domain-containing protein -
M5T41_RS13980 (2863302) 2863302..2863499 - 198 WP_000839253.1 DUF957 domain-containing protein -
M5T41_RS13985 (2863516) 2863516..2864004 - 489 WP_001054233.1 DUF5983 family protein -
M5T41_RS13990 (2864001) 2864001..2864384 - 384 WP_000854686.1 TA system toxin CbtA family protein Toxin
M5T41_RS13995 (2864465) 2864465..2864845 - 381 WP_001285602.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5T41_RS14000 (2864856) 2864856..2865539 - 684 WP_000086768.1 hypothetical protein -
M5T41_RS14005 (2865558) 2865558..2865779 - 222 WP_000692298.1 DUF987 domain-containing protein -
M5T41_RS14010 (2865842) 2865842..2866318 - 477 WP_001186726.1 RadC family protein -
M5T41_RS14015 (2866334) 2866334..2866819 - 486 WP_000214307.1 antirestriction protein -
M5T41_RS14020 (2866911) 2866911..2867729 - 819 WP_001234732.1 DUF932 domain-containing protein -
M5T41_RS14025 (2867829) 2867829..2868062 - 234 WP_001119717.1 DUF905 family protein -
M5T41_RS14030 (2868141) 2868141..2868596 - 456 WP_001504120.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-113)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14272.28 Da        Isoelectric Point: 6.8614

>T256261 WP_000854686.1 NZ_CP103704:c2864384-2864001 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ

Download         Length: 384 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13938.69 Da        Isoelectric Point: 5.0823

>AT256261 WP_001285602.1 NZ_CP103704:c2864845-2864465 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References