Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2864001..2864845 | Replicon | chromosome |
| Accession | NZ_CP103704 | ||
| Organism | Escherichia coli strain ST361 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | B1LJY4 |
| Locus tag | M5T41_RS13990 | Protein ID | WP_000854686.1 |
| Coordinates | 2864001..2864384 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A8E0J1S3 |
| Locus tag | M5T41_RS13995 | Protein ID | WP_001285602.1 |
| Coordinates | 2864465..2864845 (-) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T41_RS13950 (2859003) | 2859003..2859494 | - | 492 | WP_001300785.1 | DUF1097 domain-containing protein | - |
| M5T41_RS13955 (2859596) | 2859596..2860150 | - | 555 | WP_001001921.1 | molecular chaperone YcdY | - |
| M5T41_RS13960 (2860174) | 2860174..2860911 | - | 738 | WP_000283667.1 | zinc-binding phosphatase | - |
| M5T41_RS13965 (2860966) | 2860966..2861904 | - | 939 | WP_000351317.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| M5T41_RS13975 (2862375) | 2862375..2863217 | - | 843 | WP_001431817.1 | DUF4942 domain-containing protein | - |
| M5T41_RS13980 (2863302) | 2863302..2863499 | - | 198 | WP_000839253.1 | DUF957 domain-containing protein | - |
| M5T41_RS13985 (2863516) | 2863516..2864004 | - | 489 | WP_001054233.1 | DUF5983 family protein | - |
| M5T41_RS13990 (2864001) | 2864001..2864384 | - | 384 | WP_000854686.1 | TA system toxin CbtA family protein | Toxin |
| M5T41_RS13995 (2864465) | 2864465..2864845 | - | 381 | WP_001285602.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5T41_RS14000 (2864856) | 2864856..2865539 | - | 684 | WP_000086768.1 | hypothetical protein | - |
| M5T41_RS14005 (2865558) | 2865558..2865779 | - | 222 | WP_000692298.1 | DUF987 domain-containing protein | - |
| M5T41_RS14010 (2865842) | 2865842..2866318 | - | 477 | WP_001186726.1 | RadC family protein | - |
| M5T41_RS14015 (2866334) | 2866334..2866819 | - | 486 | WP_000214307.1 | antirestriction protein | - |
| M5T41_RS14020 (2866911) | 2866911..2867729 | - | 819 | WP_001234732.1 | DUF932 domain-containing protein | - |
| M5T41_RS14025 (2867829) | 2867829..2868062 | - | 234 | WP_001119717.1 | DUF905 family protein | - |
| M5T41_RS14030 (2868141) | 2868141..2868596 | - | 456 | WP_001504120.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14272.28 Da Isoelectric Point: 6.8614
>T256261 WP_000854686.1 NZ_CP103704:c2864384-2864001 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
Download Length: 384 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13938.69 Da Isoelectric Point: 5.0823
>AT256261 WP_001285602.1 NZ_CP103704:c2864845-2864465 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|