Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2409824..2410462 | Replicon | chromosome |
| Accession | NZ_CP103704 | ||
| Organism | Escherichia coli strain ST361 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | M5T41_RS11635 | Protein ID | WP_000813794.1 |
| Coordinates | 2410286..2410462 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | M5T41_RS11630 | Protein ID | WP_001270286.1 |
| Coordinates | 2409824..2410240 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T41_RS11610 (2404976) | 2404976..2405917 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
| M5T41_RS11615 (2405918) | 2405918..2406931 | - | 1014 | WP_000220399.1 | ABC transporter ATP-binding protein | - |
| M5T41_RS11620 (2406949) | 2406949..2408094 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| M5T41_RS11625 (2408339) | 2408339..2409745 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| M5T41_RS11630 (2409824) | 2409824..2410240 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| M5T41_RS11635 (2410286) | 2410286..2410462 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| M5T41_RS11640 (2410684) | 2410684..2410914 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| M5T41_RS11645 (2411006) | 2411006..2412967 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| M5T41_RS11650 (2413040) | 2413040..2413576 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| M5T41_RS11655 (2413668) | 2413668..2414843 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T256260 WP_000813794.1 NZ_CP103704:c2410462-2410286 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT256260 WP_001270286.1 NZ_CP103704:c2410240-2409824 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|