Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 1821435..1822270 | Replicon | chromosome |
Accession | NZ_CP103704 | ||
Organism | Escherichia coli strain ST361 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | M5T41_RS08585 | Protein ID | WP_064221650.1 |
Coordinates | 1821435..1821812 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | S1NM52 |
Locus tag | M5T41_RS08590 | Protein ID | WP_001295723.1 |
Coordinates | 1821902..1822270 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T41_RS08550 (1816955) | 1816955..1817428 | + | 474 | WP_001105407.1 | DNA gyrase inhibitor SbmC | - |
M5T41_RS08555 (1817626) | 1817626..1818684 | + | 1059 | WP_001200895.1 | FUSC family protein | - |
M5T41_RS08560 (1818856) | 1818856..1819185 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
M5T41_RS08565 (1819286) | 1819286..1819651 | - | 366 | WP_001280454.1 | EutP/PduV family microcompartment system protein | - |
M5T41_RS08570 (1819922) | 1819922..1820311 | - | 390 | WP_077875581.1 | transposase | - |
M5T41_RS08575 (1821109) | 1821109..1821189 | - | 81 | Protein_1676 | hypothetical protein | - |
M5T41_RS08580 (1821289) | 1821289..1821438 | - | 150 | Protein_1677 | DUF5983 family protein | - |
M5T41_RS08585 (1821435) | 1821435..1821812 | - | 378 | WP_064221650.1 | TA system toxin CbtA family protein | Toxin |
M5T41_RS08590 (1821902) | 1821902..1822270 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M5T41_RS08595 (1822433) | 1822433..1822654 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
M5T41_RS08600 (1822717) | 1822717..1823193 | - | 477 | WP_001186775.1 | RadC family protein | - |
M5T41_RS08605 (1823209) | 1823209..1823694 | - | 486 | WP_000849588.1 | antirestriction protein | - |
M5T41_RS08610 (1823749) | 1823749..1824567 | - | 819 | WP_072649824.1 | DUF932 domain-containing protein | - |
M5T41_RS08615 (1824685) | 1824685..1824880 | - | 196 | Protein_1684 | DUF905 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14150.14 Da Isoelectric Point: 7.3249
>T256254 WP_064221650.1 NZ_CP103704:c1821812-1821435 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTQLARLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTQLARLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT256254 WP_001295723.1 NZ_CP103704:c1822270-1821902 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|