Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4771968..4772484 | Replicon | chromosome |
Accession | NZ_CP103699 | ||
Organism | Klebsiella pneumoniae strain ST307 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | M5R30_RS23215 | Protein ID | WP_004178374.1 |
Coordinates | 4771968..4772252 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A919M0P8 |
Locus tag | M5R30_RS23220 | Protein ID | WP_032434351.1 |
Coordinates | 4772242..4772484 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R30_RS23190 (4767451) | 4767451..4767714 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
M5R30_RS23195 (4767844) | 4767844..4768017 | + | 174 | WP_032414379.1 | hypothetical protein | - |
M5R30_RS23200 (4768020) | 4768020..4768763 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
M5R30_RS23205 (4769120) | 4769120..4771258 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
M5R30_RS23210 (4771500) | 4771500..4771964 | + | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
M5R30_RS23215 (4771968) | 4771968..4772252 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5R30_RS23220 (4772242) | 4772242..4772484 | - | 243 | WP_032434351.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M5R30_RS23225 (4772562) | 4772562..4774472 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
M5R30_RS23230 (4774495) | 4774495..4775649 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
M5R30_RS23235 (4775715) | 4775715..4776455 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T256244 WP_004178374.1 NZ_CP103699:c4772252-4771968 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|