Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 4679240..4679943 | Replicon | chromosome |
| Accession | NZ_CP103699 | ||
| Organism | Klebsiella pneumoniae strain ST307 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | A0A939NMR5 |
| Locus tag | M5R30_RS22820 | Protein ID | WP_071994632.1 |
| Coordinates | 4679240..4679581 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A939NIK9 |
| Locus tag | M5R30_RS22825 | Protein ID | WP_032434296.1 |
| Coordinates | 4679602..4679943 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R30_RS22810 (4675555) | 4675555..4676424 | + | 870 | WP_023317468.1 | HNH endonuclease | - |
| M5R30_RS22815 (4677015) | 4677015..4679048 | + | 2034 | WP_050598589.1 | hypothetical protein | - |
| M5R30_RS22820 (4679240) | 4679240..4679581 | - | 342 | WP_071994632.1 | TA system toxin CbtA family protein | Toxin |
| M5R30_RS22825 (4679602) | 4679602..4679943 | - | 342 | WP_032434296.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5R30_RS22830 (4679954) | 4679954..4680496 | - | 543 | WP_032434298.1 | DNA repair protein RadC | - |
| M5R30_RS22835 (4680509) | 4680509..4680949 | - | 441 | WP_032434300.1 | antirestriction protein | - |
| M5R30_RS22840 (4680980) | 4680980..4681801 | - | 822 | WP_032434301.1 | DUF932 domain-containing protein | - |
| M5R30_RS22845 (4681921) | 4681921..4682394 | - | 474 | WP_032434303.1 | hypothetical protein | - |
| M5R30_RS22850 (4682466) | 4682466..4682918 | - | 453 | WP_032410767.1 | hypothetical protein | - |
| M5R30_RS22855 (4682954) | 4682954..4683670 | - | 717 | WP_032434305.1 | WYL domain-containing protein | - |
| M5R30_RS22860 (4683914) | 4683914..4684788 | - | 875 | Protein_4478 | GTPase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4667537..4713210 | 45673 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12789.77 Da Isoelectric Point: 9.6552
>T256243 WP_071994632.1 NZ_CP103699:c4679581-4679240 [Klebsiella pneumoniae]
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|