Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4006868..4007487 | Replicon | chromosome |
Accession | NZ_CP103699 | ||
Organism | Klebsiella pneumoniae strain ST307 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | M5R30_RS19605 | Protein ID | WP_002892050.1 |
Coordinates | 4007269..4007487 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | M5R30_RS19600 | Protein ID | WP_002892066.1 |
Coordinates | 4006868..4007242 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R30_RS19590 (4002020) | 4002020..4003213 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M5R30_RS19595 (4003236) | 4003236..4006382 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
M5R30_RS19600 (4006868) | 4006868..4007242 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
M5R30_RS19605 (4007269) | 4007269..4007487 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
M5R30_RS19610 (4007646) | 4007646..4008212 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
M5R30_RS19615 (4008184) | 4008184..4008324 | - | 141 | WP_004147370.1 | hypothetical protein | - |
M5R30_RS19620 (4008345) | 4008345..4008815 | + | 471 | WP_002892026.1 | YlaC family protein | - |
M5R30_RS19625 (4008790) | 4008790..4010241 | - | 1452 | WP_032435563.1 | PLP-dependent aminotransferase family protein | - |
M5R30_RS19630 (4010342) | 4010342..4011040 | + | 699 | WP_032435564.1 | GNAT family protein | - |
M5R30_RS19635 (4011037) | 4011037..4011177 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
M5R30_RS19640 (4011177) | 4011177..4011440 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T256241 WP_002892050.1 NZ_CP103699:4007269-4007487 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT256241 WP_002892066.1 NZ_CP103699:4006868-4007242 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |