Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 53658..54394 Replicon plasmid pMB3713_1
Accession NZ_CP103698
Organism Klebsiella pneumoniae strain ST3576

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag M5R27_RS27100 Protein ID WP_003026803.1
Coordinates 53912..54394 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag M5R27_RS27095 Protein ID WP_003026799.1
Coordinates 53658..53924 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R27_RS27050 (M5R27_27050) 49720..50082 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
M5R27_RS27055 (M5R27_27055) 50132..50482 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
M5R27_RS27060 (M5R27_27060) 50840..51109 + 270 WP_004152102.1 hypothetical protein -
M5R27_RS27065 (M5R27_27065) 51097..51672 + 576 WP_004152103.1 hypothetical protein -
M5R27_RS27070 (M5R27_27070) 51703..52197 + 495 WP_004152104.1 DNA-binding protein -
M5R27_RS27075 (M5R27_27075) 52241..52609 + 369 WP_004152105.1 hypothetical protein -
M5R27_RS27080 (M5R27_27080) 52643..52846 + 204 WP_004152106.1 HHA domain-containing protein -
M5R27_RS27085 (M5R27_27085) 52895..53152 + 258 WP_004152107.1 hypothetical protein -
M5R27_RS27090 (M5R27_27090) 53228..53482 + 255 WP_004152108.1 hypothetical protein -
M5R27_RS27095 (M5R27_27095) 53658..53924 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
M5R27_RS27100 (M5R27_27100) 53912..54394 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
M5R27_RS27105 (M5R27_27105) 54602..55948 + 1347 WP_077253535.1 ISNCY family transposase -
M5R27_RS27110 (M5R27_27110) 55997..56392 + 396 WP_004143398.1 helix-turn-helix domain-containing protein -
M5R27_RS27115 (M5R27_27115) 56540..57705 - 1166 Protein_59 IS3 family transposase -
M5R27_RS27120 (M5R27_27120) 57882..58844 - 963 WP_004152113.1 zinc metalloprotease HtpX -
M5R27_RS27125 (M5R27_27125) 58831..59319 - 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..172383 172383


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T256231 WP_003026803.1 NZ_CP103698:53912-54394 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT256231 WP_003026799.1 NZ_CP103698:53658-53924 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References