Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 53658..54394 | Replicon | plasmid pMB3713_1 |
| Accession | NZ_CP103698 | ||
| Organism | Klebsiella pneumoniae strain ST3576 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | M5R27_RS27100 | Protein ID | WP_003026803.1 |
| Coordinates | 53912..54394 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | M5R27_RS27095 | Protein ID | WP_003026799.1 |
| Coordinates | 53658..53924 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R27_RS27050 (M5R27_27050) | 49720..50082 | - | 363 | WP_004152100.1 | arsenite efflux transporter metallochaperone ArsD | - |
| M5R27_RS27055 (M5R27_27055) | 50132..50482 | - | 351 | WP_004152101.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| M5R27_RS27060 (M5R27_27060) | 50840..51109 | + | 270 | WP_004152102.1 | hypothetical protein | - |
| M5R27_RS27065 (M5R27_27065) | 51097..51672 | + | 576 | WP_004152103.1 | hypothetical protein | - |
| M5R27_RS27070 (M5R27_27070) | 51703..52197 | + | 495 | WP_004152104.1 | DNA-binding protein | - |
| M5R27_RS27075 (M5R27_27075) | 52241..52609 | + | 369 | WP_004152105.1 | hypothetical protein | - |
| M5R27_RS27080 (M5R27_27080) | 52643..52846 | + | 204 | WP_004152106.1 | HHA domain-containing protein | - |
| M5R27_RS27085 (M5R27_27085) | 52895..53152 | + | 258 | WP_004152107.1 | hypothetical protein | - |
| M5R27_RS27090 (M5R27_27090) | 53228..53482 | + | 255 | WP_004152108.1 | hypothetical protein | - |
| M5R27_RS27095 (M5R27_27095) | 53658..53924 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| M5R27_RS27100 (M5R27_27100) | 53912..54394 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| M5R27_RS27105 (M5R27_27105) | 54602..55948 | + | 1347 | WP_077253535.1 | ISNCY family transposase | - |
| M5R27_RS27110 (M5R27_27110) | 55997..56392 | + | 396 | WP_004143398.1 | helix-turn-helix domain-containing protein | - |
| M5R27_RS27115 (M5R27_27115) | 56540..57705 | - | 1166 | Protein_59 | IS3 family transposase | - |
| M5R27_RS27120 (M5R27_27120) | 57882..58844 | - | 963 | WP_004152113.1 | zinc metalloprotease HtpX | - |
| M5R27_RS27125 (M5R27_27125) | 58831..59319 | - | 489 | WP_004152114.1 | phosphate-starvation-inducible PsiE family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..172383 | 172383 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T256231 WP_003026803.1 NZ_CP103698:53912-54394 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |