Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 5035836..5036493 | Replicon | chromosome |
Accession | NZ_CP103697 | ||
Organism | Klebsiella pneumoniae strain ST3576 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | M5R27_RS24380 | Protein ID | WP_002916310.1 |
Coordinates | 5036083..5036493 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | M5R27_RS24375 | Protein ID | WP_002916312.1 |
Coordinates | 5035836..5036102 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R27_RS24350 (M5R27_24350) | 5030992..5032425 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
M5R27_RS24355 (M5R27_24355) | 5032544..5033272 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
M5R27_RS24360 (M5R27_24360) | 5033322..5033633 | + | 312 | WP_002916319.1 | N(4)-acetylcytidine aminohydrolase | - |
M5R27_RS24365 (M5R27_24365) | 5033797..5034456 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
M5R27_RS24370 (M5R27_24370) | 5034607..5035590 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
M5R27_RS24375 (M5R27_24375) | 5035836..5036102 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
M5R27_RS24380 (M5R27_24380) | 5036083..5036493 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
M5R27_RS24385 (M5R27_24385) | 5036500..5037021 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
M5R27_RS24390 (M5R27_24390) | 5037122..5038018 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
M5R27_RS24395 (M5R27_24395) | 5038041..5038754 | + | 714 | WP_004174456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M5R27_RS24400 (M5R27_24400) | 5038760..5040493 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T256230 WP_002916310.1 NZ_CP103697:5036083-5036493 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |