Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4573128..4573714 Replicon chromosome
Accession NZ_CP103697
Organism Klebsiella pneumoniae strain ST3576

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag M5R27_RS21980 Protein ID WP_002920800.1
Coordinates 4573346..4573714 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag M5R27_RS21975 Protein ID WP_004174006.1
Coordinates 4573128..4573349 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R27_RS21955 (M5R27_21955) 4569285..4570211 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
M5R27_RS21960 (M5R27_21960) 4570208..4571485 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
M5R27_RS21965 (M5R27_21965) 4571482..4572249 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M5R27_RS21970 (M5R27_21970) 4572251..4572964 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M5R27_RS21975 (M5R27_21975) 4573128..4573349 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M5R27_RS21980 (M5R27_21980) 4573346..4573714 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M5R27_RS21985 (M5R27_21985) 4573987..4575303 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M5R27_RS21990 (M5R27_21990) 4575410..4576297 + 888 WP_121915221.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M5R27_RS21995 (M5R27_21995) 4576294..4577139 + 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M5R27_RS22000 (M5R27_22000) 4577141..4578211 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr / tet(A) / qnrB1 / blaCTX-M-15 / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / sul2 - 4496339..4573714 77375


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T256228 WP_002920800.1 NZ_CP103697:4573346-4573714 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT256228 WP_004174006.1 NZ_CP103697:4573128-4573349 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References