Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 4370128..4370867 | Replicon | chromosome |
| Accession | NZ_CP103697 | ||
| Organism | Klebsiella pneumoniae strain ST3576 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | M5R27_RS21070 | Protein ID | WP_021312536.1 |
| Coordinates | 4370382..4370867 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | M5R27_RS21065 | Protein ID | WP_003026799.1 |
| Coordinates | 4370128..4370394 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R27_RS21050 (M5R27_21050) | 4366772..4368141 | + | 1370 | WP_087830479.1 | IS3 family transposase | - |
| M5R27_RS21060 (M5R27_21060) | 4369567..4369995 | + | 429 | WP_004901287.1 | GFA family protein | - |
| M5R27_RS21065 (M5R27_21065) | 4370128..4370394 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| M5R27_RS21070 (M5R27_21070) | 4370382..4370867 | + | 486 | WP_021312536.1 | GNAT family N-acetyltransferase | Toxin |
| M5R27_RS21075 (M5R27_21075) | 4371211..4371363 | + | 153 | WP_002922102.1 | type I toxin-antitoxin system toxin HokA | - |
| M5R27_RS21080 (M5R27_21080) | 4371665..4373284 | + | 1620 | WP_040221779.1 | ATP-binding cassette domain-containing protein | - |
| M5R27_RS21085 (M5R27_21085) | 4373383..4373595 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| M5R27_RS21090 (M5R27_21090) | 4373848..4374138 | - | 291 | WP_002921931.1 | HTH-type transcriptional regulator | - |
| M5R27_RS21095 (M5R27_21095) | 4374384..4375739 | - | 1356 | WP_002921930.1 | aromatic acid/H+ symport family MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17608.39 Da Isoelectric Point: 10.3370
>T256227 WP_021312536.1 NZ_CP103697:4370382-4370867 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|