Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4085153..4085778 | Replicon | chromosome |
| Accession | NZ_CP103697 | ||
| Organism | Klebsiella pneumoniae strain ST3576 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A378FVD4 |
| Locus tag | M5R27_RS19700 | Protein ID | WP_019705794.1 |
| Coordinates | 4085153..4085536 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | M5R27_RS19705 | Protein ID | WP_004150355.1 |
| Coordinates | 4085536..4085778 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R27_RS19685 (M5R27_19685) | 4082519..4083421 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| M5R27_RS19690 (M5R27_19690) | 4083418..4084053 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| M5R27_RS19695 (M5R27_19695) | 4084050..4084979 | + | 930 | WP_121915261.1 | formate dehydrogenase accessory protein FdhE | - |
| M5R27_RS19700 (M5R27_19700) | 4085153..4085536 | - | 384 | WP_019705794.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M5R27_RS19705 (M5R27_19705) | 4085536..4085778 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| M5R27_RS19710 (M5R27_19710) | 4085983..4086900 | + | 918 | WP_012737090.1 | alpha/beta hydrolase | - |
| M5R27_RS19715 (M5R27_19715) | 4086914..4087855 | - | 942 | WP_012543287.1 | fatty acid biosynthesis protein FabY | - |
| M5R27_RS19720 (M5R27_19720) | 4087900..4088337 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| M5R27_RS19725 (M5R27_19725) | 4088334..4089194 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| M5R27_RS19730 (M5R27_19730) | 4089188..4089787 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14358.57 Da Isoelectric Point: 6.8806
>T256226 WP_019705794.1 NZ_CP103697:c4085536-4085153 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A378FVD4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |