Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 3554729..3555245 | Replicon | chromosome |
| Accession | NZ_CP103697 | ||
| Organism | Klebsiella pneumoniae strain ST3576 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | M5R27_RS17150 | Protein ID | WP_004178374.1 |
| Coordinates | 3554729..3555013 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | M5R27_RS17155 | Protein ID | WP_002886901.1 |
| Coordinates | 3555003..3555245 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R27_RS17125 (M5R27_17125) | 3550125..3550433 | - | 309 | WP_002886907.1 | PTS sugar transporter subunit IIB | - |
| M5R27_RS17130 (M5R27_17130) | 3550518..3550691 | + | 174 | WP_004222159.1 | hypothetical protein | - |
| M5R27_RS17135 (M5R27_17135) | 3550694..3551437 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| M5R27_RS17140 (M5R27_17140) | 3551794..3553932 | + | 2139 | WP_032415880.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| M5R27_RS17145 (M5R27_17145) | 3554261..3554725 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| M5R27_RS17150 (M5R27_17150) | 3554729..3555013 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5R27_RS17155 (M5R27_17155) | 3555003..3555245 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| M5R27_RS17160 (M5R27_17160) | 3555323..3557233 | - | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
| M5R27_RS17165 (M5R27_17165) | 3557256..3558410 | - | 1155 | WP_032415878.1 | lactonase family protein | - |
| M5R27_RS17170 (M5R27_17170) | 3558477..3559217 | - | 741 | WP_004186692.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T256224 WP_004178374.1 NZ_CP103697:c3555013-3554729 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6THG1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |