Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 3440134..3440944 | Replicon | chromosome |
Accession | NZ_CP103697 | ||
Organism | Klebsiella pneumoniae strain ST3576 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A060VJ83 |
Locus tag | M5R27_RS16670 | Protein ID | WP_004178461.1 |
Coordinates | 3440134..3440667 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | M5R27_RS16675 | Protein ID | WP_002887278.1 |
Coordinates | 3440678..3440944 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R27_RS16665 (M5R27_16665) | 3438965..3440086 | + | 1122 | WP_012737335.1 | cupin domain-containing protein | - |
M5R27_RS16670 (M5R27_16670) | 3440134..3440667 | - | 534 | WP_004178461.1 | type II toxin-antitoxin system toxin KacT | Toxin |
M5R27_RS16675 (M5R27_16675) | 3440678..3440944 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
M5R27_RS16680 (M5R27_16680) | 3441047..3442480 | - | 1434 | WP_032415907.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
M5R27_RS16685 (M5R27_16685) | 3442470..3443153 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
M5R27_RS16690 (M5R27_16690) | 3443326..3444711 | + | 1386 | WP_026005908.1 | efflux transporter outer membrane subunit | - |
M5R27_RS16695 (M5R27_16695) | 3444729..3445073 | + | 345 | WP_004894569.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19810.65 Da Isoelectric Point: 5.2614
>T256223 WP_004178461.1 NZ_CP103697:c3440667-3440134 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060VJ83 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |