Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 2828358..2828977 Replicon chromosome
Accession NZ_CP103697
Organism Klebsiella pneumoniae strain ST3576

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M5R27_RS13730 Protein ID WP_002892050.1
Coordinates 2828759..2828977 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M5R27_RS13725 Protein ID WP_002892066.1
Coordinates 2828358..2828732 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R27_RS13715 (M5R27_13715) 2823510..2824703 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M5R27_RS13720 (M5R27_13720) 2824726..2827872 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M5R27_RS13725 (M5R27_13725) 2828358..2828732 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M5R27_RS13730 (M5R27_13730) 2828759..2828977 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M5R27_RS13735 (M5R27_13735) 2829136..2829702 + 567 WP_002892030.1 maltose O-acetyltransferase -
M5R27_RS13740 (M5R27_13740) 2829674..2829814 - 141 WP_004147370.1 hypothetical protein -
M5R27_RS13745 (M5R27_13745) 2829835..2830305 + 471 WP_002892026.1 YlaC family protein -
M5R27_RS13750 (M5R27_13750) 2830280..2831730 - 1451 Protein_2701 PLP-dependent aminotransferase family protein -
M5R27_RS13755 (M5R27_13755) 2831831..2832529 + 699 WP_002892021.1 GNAT family protein -
M5R27_RS13760 (M5R27_13760) 2832526..2832666 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M5R27_RS13765 (M5R27_13765) 2832666..2832929 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T256222 WP_002892050.1 NZ_CP103697:2828759-2828977 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT256222 WP_002892066.1 NZ_CP103697:2828358-2828732 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References