Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataT-KacA/DUF1778(antitoxin) |
Location | 33412..34210 | Replicon | plasmid pMB3825A_2 |
Accession | NZ_CP103696 | ||
Organism | Escherichia coli strain ST12468 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | E2QDF3 |
Locus tag | M5T31_RS23650 | Protein ID | WP_000072677.1 |
Coordinates | 33689..34210 (+) | Length | 174 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | A0A0V9R6Q7 |
Locus tag | M5T31_RS23645 | Protein ID | WP_001351987.1 |
Coordinates | 33412..33681 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T31_RS23620 (M5T31_23620) | 28839..30179 | - | 1341 | WP_000137333.1 | DnaB-like helicase C-terminal domain-containing protein | - |
M5T31_RS23625 (M5T31_23625) | 30223..30963 | - | 741 | WP_001717320.1 | hypothetical protein | - |
M5T31_RS23630 (M5T31_23630) | 31246..32013 | + | 768 | WP_000342417.1 | hypothetical protein | - |
M5T31_RS23635 (M5T31_23635) | 32066..32419 | - | 354 | WP_160378290.1 | hypothetical protein | - |
M5T31_RS23640 (M5T31_23640) | 32425..33093 | - | 669 | WP_000161228.1 | division plane positioning ATPase MipZ | - |
M5T31_RS23645 (M5T31_23645) | 33412..33681 | + | 270 | WP_001351987.1 | DUF1778 domain-containing protein | Antitoxin |
M5T31_RS23650 (M5T31_23650) | 33689..34210 | + | 522 | WP_000072677.1 | GNAT family N-acetyltransferase | Toxin |
M5T31_RS23655 (M5T31_23655) | 34379..34630 | - | 252 | WP_000901559.1 | hypothetical protein | - |
M5T31_RS23660 (M5T31_23660) | 34632..35324 | - | 693 | WP_012640731.1 | hypothetical protein | - |
M5T31_RS23665 (M5T31_23665) | 35338..35661 | - | 324 | WP_000064175.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaCTX-M-14 | - | 1..114012 | 114012 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19392.17 Da Isoelectric Point: 8.6369
>T256216 WP_000072677.1 NZ_CP103696:33689-34210 [Escherichia coli]
VSNTTIEIFSGEKDYDLNGFDCGEESLNAFLANHLKRQHEGKILRAYVLCTQEERPKVLGYYTLSGSCFEKESLPSRSKQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLGFIQLVGNNERSL
FYPTKSIEKLFEE
VSNTTIEIFSGEKDYDLNGFDCGEESLNAFLANHLKRQHEGKILRAYVLCTQEERPKVLGYYTLSGSCFEKESLPSRSKQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLGFIQLVGNNERSL
FYPTKSIEKLFEE
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9R6P3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9R6Q7 |