Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 21881..22524 | Replicon | plasmid pMB3825A_1 |
Accession | NZ_CP103695 | ||
Organism | Escherichia coli strain ST12468 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | M5T31_RS22805 | Protein ID | WP_001044768.1 |
Coordinates | 22108..22524 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | M5T31_RS22800 | Protein ID | WP_001261287.1 |
Coordinates | 21881..22111 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T31_RS22780 (17041) | 17041..18129 | + | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
M5T31_RS22785 (18131) | 18131..20356 | + | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
M5T31_RS22790 (20406) | 20406..21305 | - | 900 | WP_000963206.1 | nucleotide-binding protein | - |
M5T31_RS22795 (21295) | 21295..21585 | - | 291 | WP_000111771.1 | hypothetical protein | - |
M5T31_RS22800 (21881) | 21881..22111 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
M5T31_RS22805 (22108) | 22108..22524 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M5T31_RS22810 (22686) | 22686..24824 | - | 2139 | WP_000350638.1 | AAA family ATPase | - |
M5T31_RS22815 (25178) | 25178..25435 | + | 258 | WP_000343085.1 | hypothetical protein | - |
M5T31_RS22820 (25435) | 25435..26025 | + | 591 | WP_000194575.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aac(3)-IIa / tet(A) / aph(3')-Ia / sitABCD | - | 1..128470 | 128470 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T256212 WP_001044768.1 NZ_CP103695:22108-22524 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |