Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2380575..2381213 | Replicon | chromosome |
| Accession | NZ_CP103694 | ||
| Organism | Escherichia coli strain ST12468 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | M5T31_RS11690 | Protein ID | WP_000813794.1 |
| Coordinates | 2381037..2381213 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | M5T31_RS11685 | Protein ID | WP_001270286.1 |
| Coordinates | 2380575..2380991 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T31_RS11665 (2375727) | 2375727..2376668 | - | 942 | WP_001251319.1 | ABC transporter permease | - |
| M5T31_RS11670 (2376669) | 2376669..2377682 | - | 1014 | WP_000220393.1 | ABC transporter ATP-binding protein | - |
| M5T31_RS11675 (2377700) | 2377700..2378845 | - | 1146 | WP_058905745.1 | ABC transporter substrate-binding protein | - |
| M5T31_RS11680 (2379090) | 2379090..2380496 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| M5T31_RS11685 (2380575) | 2380575..2380991 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| M5T31_RS11690 (2381037) | 2381037..2381213 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| M5T31_RS11695 (2381435) | 2381435..2381665 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| M5T31_RS11700 (2381757) | 2381757..2383718 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| M5T31_RS11705 (2383791) | 2383791..2384327 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| M5T31_RS11710 (2384419) | 2384419..2385594 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T256206 WP_000813794.1 NZ_CP103694:c2381213-2381037 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT256206 WP_001270286.1 NZ_CP103694:c2380991-2380575 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|