Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 984958..985541 | Replicon | chromosome |
| Accession | NZ_CP103694 | ||
| Organism | Escherichia coli strain ST12468 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S1EZP4 |
| Locus tag | M5T31_RS04815 | Protein ID | WP_000254738.1 |
| Coordinates | 985206..985541 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A1V2T5M9 |
| Locus tag | M5T31_RS04810 | Protein ID | WP_000581941.1 |
| Coordinates | 984958..985206 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T31_RS04800 (981297) | 981297..982598 | + | 1302 | WP_023281448.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| M5T31_RS04805 (982646) | 982646..984880 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| M5T31_RS04810 (984958) | 984958..985206 | + | 249 | WP_000581941.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| M5T31_RS04815 (985206) | 985206..985541 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
| M5T31_RS04820 (985612) | 985612..986403 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| M5T31_RS04825 (986631) | 986631..988268 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| M5T31_RS04830 (988356) | 988356..989654 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | blaCTX-M-14 | - | 945622..992327 | 46705 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T256199 WP_000254738.1 NZ_CP103694:985206-985541 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|