Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 4709369..4710072 | Replicon | chromosome |
| Accession | NZ_CP103687 | ||
| Organism | Klebsiella pneumoniae strain ST307 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | A0A939NMR5 |
| Locus tag | M5S48_RS23045 | Protein ID | WP_071994632.1 |
| Coordinates | 4709369..4709710 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A939NIK9 |
| Locus tag | M5S48_RS23050 | Protein ID | WP_032434296.1 |
| Coordinates | 4709731..4710072 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S48_RS23035 (4705684) | 4705684..4706553 | + | 870 | WP_023317468.1 | HNH endonuclease | - |
| M5S48_RS23040 (4707144) | 4707144..4709177 | + | 2034 | WP_259426111.1 | hypothetical protein | - |
| M5S48_RS23045 (4709369) | 4709369..4709710 | - | 342 | WP_071994632.1 | TA system toxin CbtA family protein | Toxin |
| M5S48_RS23050 (4709731) | 4709731..4710072 | - | 342 | WP_032434296.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5S48_RS23055 (4710083) | 4710083..4710625 | - | 543 | WP_032434298.1 | DNA repair protein RadC | - |
| M5S48_RS23060 (4710638) | 4710638..4711078 | - | 441 | WP_032434300.1 | antirestriction protein | - |
| M5S48_RS23065 (4711109) | 4711109..4711930 | - | 822 | WP_032434301.1 | DUF932 domain-containing protein | - |
| M5S48_RS23070 (4712050) | 4712050..4712523 | - | 474 | WP_032434303.1 | hypothetical protein | - |
| M5S48_RS23075 (4712595) | 4712595..4713047 | - | 453 | WP_032410767.1 | hypothetical protein | - |
| M5S48_RS23080 (4713083) | 4713083..4713799 | - | 717 | WP_032434305.1 | WYL domain-containing protein | - |
| M5S48_RS23085 (4714043) | 4714043..4714917 | - | 875 | Protein_4523 | GTPase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4697666..4743339 | 45673 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12789.77 Da Isoelectric Point: 9.6552
>T256190 WP_071994632.1 NZ_CP103687:c4709710-4709369 [Klebsiella pneumoniae]
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|