Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4036997..4037616 Replicon chromosome
Accession NZ_CP103687
Organism Klebsiella pneumoniae strain ST307

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M5S48_RS19830 Protein ID WP_002892050.1
Coordinates 4037398..4037616 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M5S48_RS19825 Protein ID WP_002892066.1
Coordinates 4036997..4037371 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S48_RS19815 (4032149) 4032149..4033342 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M5S48_RS19820 (4033365) 4033365..4036511 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M5S48_RS19825 (4036997) 4036997..4037371 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M5S48_RS19830 (4037398) 4037398..4037616 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M5S48_RS19835 (4037775) 4037775..4038341 + 567 WP_002892030.1 maltose O-acetyltransferase -
M5S48_RS19840 (4038313) 4038313..4038453 - 141 WP_004147370.1 hypothetical protein -
M5S48_RS19845 (4038474) 4038474..4038944 + 471 WP_002892026.1 YlaC family protein -
M5S48_RS19850 (4038919) 4038919..4040370 - 1452 WP_032435563.1 PLP-dependent aminotransferase family protein -
M5S48_RS19855 (4040471) 4040471..4041169 + 699 WP_032435564.1 GNAT family protein -
M5S48_RS19860 (4041166) 4041166..4041306 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M5S48_RS19865 (4041306) 4041306..4041569 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T256188 WP_002892050.1 NZ_CP103687:4037398-4037616 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT256188 WP_002892066.1 NZ_CP103687:4036997-4037371 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References