Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4036997..4037616 | Replicon | chromosome |
Accession | NZ_CP103687 | ||
Organism | Klebsiella pneumoniae strain ST307 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | M5S48_RS19830 | Protein ID | WP_002892050.1 |
Coordinates | 4037398..4037616 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | M5S48_RS19825 | Protein ID | WP_002892066.1 |
Coordinates | 4036997..4037371 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S48_RS19815 (4032149) | 4032149..4033342 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M5S48_RS19820 (4033365) | 4033365..4036511 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
M5S48_RS19825 (4036997) | 4036997..4037371 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
M5S48_RS19830 (4037398) | 4037398..4037616 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
M5S48_RS19835 (4037775) | 4037775..4038341 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
M5S48_RS19840 (4038313) | 4038313..4038453 | - | 141 | WP_004147370.1 | hypothetical protein | - |
M5S48_RS19845 (4038474) | 4038474..4038944 | + | 471 | WP_002892026.1 | YlaC family protein | - |
M5S48_RS19850 (4038919) | 4038919..4040370 | - | 1452 | WP_032435563.1 | PLP-dependent aminotransferase family protein | - |
M5S48_RS19855 (4040471) | 4040471..4041169 | + | 699 | WP_032435564.1 | GNAT family protein | - |
M5S48_RS19860 (4041166) | 4041166..4041306 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
M5S48_RS19865 (4041306) | 4041306..4041569 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T256188 WP_002892050.1 NZ_CP103687:4037398-4037616 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT256188 WP_002892066.1 NZ_CP103687:4036997-4037371 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |