Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 57970..58613 | Replicon | plasmid pMB4528V_2 |
| Accession | NZ_CP103685 | ||
| Organism | Enterobacter hormaechei strain ST90 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | M5S84_RS25240 | Protein ID | WP_001044770.1 |
| Coordinates | 57970..58386 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | M5S84_RS25245 | Protein ID | WP_141438078.1 |
| Coordinates | 58383..58613 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S84_RS25210 (M5S84_25210) | 54217..54591 | + | 375 | WP_004118534.1 | fluoride efflux transporter CrcB | - |
| M5S84_RS25215 (M5S84_25215) | 54579..54710 | + | 132 | WP_259420316.1 | hypothetical protein | - |
| M5S84_RS25220 (M5S84_25220) | 54866..56014 | + | 1149 | WP_011977829.1 | Na+/H+ antiporter NhaA | - |
| M5S84_RS25225 (M5S84_25225) | 56368..56700 | - | 333 | WP_004118538.1 | multidrug efflux SMR transporter | - |
| M5S84_RS25230 (M5S84_25230) | 56909..57613 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| M5S84_RS25235 (M5S84_25235) | 57678..57896 | - | 219 | Protein_72 | AAA family ATPase | - |
| M5S84_RS25240 (M5S84_25240) | 57970..58386 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M5S84_RS25245 (M5S84_25245) | 58383..58613 | - | 231 | WP_141438078.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M5S84_RS25250 (M5S84_25250) | 58570..59031 | + | 462 | WP_187590726.1 | hypothetical protein | - |
| M5S84_RS25255 (M5S84_25255) | 59175..59525 | + | 351 | WP_040119804.1 | hypothetical protein | - |
| M5S84_RS25260 (M5S84_25260) | 59576..60319 | + | 744 | WP_000129823.1 | hypothetical protein | - |
| M5S84_RS25265 (M5S84_25265) | 60316..61092 | + | 777 | WP_000015958.1 | site-specific integrase | - |
| M5S84_RS25270 (M5S84_25270) | 61150..61407 | - | 258 | WP_000764642.1 | hypothetical protein | - |
| M5S84_RS25275 (M5S84_25275) | 61536..61640 | - | 105 | WP_032409716.1 | hypothetical protein | - |
| M5S84_RS25280 (M5S84_25280) | 62175..63041 | + | 867 | WP_004118283.1 | replication initiation protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..64082 | 64082 | |
| - | flank | IS/Tn | - | - | 56909..57613 | 704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T256178 WP_001044770.1 NZ_CP103685:c58386-57970 [Enterobacter hormaechei]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|