Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 57970..58613 Replicon plasmid pMB4528V_2
Accession NZ_CP103685
Organism Enterobacter hormaechei strain ST90

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag M5S84_RS25240 Protein ID WP_001044770.1
Coordinates 57970..58386 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag M5S84_RS25245 Protein ID WP_141438078.1
Coordinates 58383..58613 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S84_RS25210 (M5S84_25210) 54217..54591 + 375 WP_004118534.1 fluoride efflux transporter CrcB -
M5S84_RS25215 (M5S84_25215) 54579..54710 + 132 WP_259420316.1 hypothetical protein -
M5S84_RS25220 (M5S84_25220) 54866..56014 + 1149 WP_011977829.1 Na+/H+ antiporter NhaA -
M5S84_RS25225 (M5S84_25225) 56368..56700 - 333 WP_004118538.1 multidrug efflux SMR transporter -
M5S84_RS25230 (M5S84_25230) 56909..57613 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
M5S84_RS25235 (M5S84_25235) 57678..57896 - 219 Protein_72 AAA family ATPase -
M5S84_RS25240 (M5S84_25240) 57970..58386 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
M5S84_RS25245 (M5S84_25245) 58383..58613 - 231 WP_141438078.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M5S84_RS25250 (M5S84_25250) 58570..59031 + 462 WP_187590726.1 hypothetical protein -
M5S84_RS25255 (M5S84_25255) 59175..59525 + 351 WP_040119804.1 hypothetical protein -
M5S84_RS25260 (M5S84_25260) 59576..60319 + 744 WP_000129823.1 hypothetical protein -
M5S84_RS25265 (M5S84_25265) 60316..61092 + 777 WP_000015958.1 site-specific integrase -
M5S84_RS25270 (M5S84_25270) 61150..61407 - 258 WP_000764642.1 hypothetical protein -
M5S84_RS25275 (M5S84_25275) 61536..61640 - 105 WP_032409716.1 hypothetical protein -
M5S84_RS25280 (M5S84_25280) 62175..63041 + 867 WP_004118283.1 replication initiation protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..64082 64082
- flank IS/Tn - - 56909..57613 704


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T256178 WP_001044770.1 NZ_CP103685:c58386-57970 [Enterobacter hormaechei]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8698.79 Da        Isoelectric Point: 4.6017

>AT256178 WP_141438078.1 NZ_CP103685:c58613-58383 [Enterobacter hormaechei]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKAGPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure

References