Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 253271..253797 | Replicon | plasmid pMB4528V_1 |
Accession | NZ_CP103684 | ||
Organism | Enterobacter hormaechei strain ST90 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | M5S84_RS24135 | Protein ID | WP_000323025.1 |
Coordinates | 253271..253558 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | M5S84_RS24140 | Protein ID | WP_000534858.1 |
Coordinates | 253558..253797 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S84_RS24075 (M5S84_24075) | 248606..248989 | + | 384 | WP_050596975.1 | hypothetical protein | - |
M5S84_RS24080 (M5S84_24080) | 249000..249254 | + | 255 | WP_032610479.1 | hypothetical protein | - |
M5S84_RS24085 (M5S84_24085) | 249254..249670 | + | 417 | WP_032610480.1 | hypothetical protein | - |
M5S84_RS24090 (M5S84_24090) | 249670..249801 | + | 132 | WP_255344485.1 | hypothetical protein | - |
M5S84_RS24095 (M5S84_24095) | 249788..250069 | + | 282 | WP_032610524.1 | hypothetical protein | - |
M5S84_RS24100 (M5S84_24100) | 250255..250809 | + | 555 | WP_015063016.1 | hypothetical protein | - |
M5S84_RS24105 (M5S84_24105) | 250869..251117 | + | 249 | WP_050596976.1 | hypothetical protein | - |
M5S84_RS24110 (M5S84_24110) | 251242..251574 | + | 333 | WP_032610481.1 | DUF5417 domain-containing protein | - |
M5S84_RS24115 (M5S84_24115) | 251619..252188 | + | 570 | WP_032610483.1 | hypothetical protein | - |
M5S84_RS24120 (M5S84_24120) | 252212..252562 | + | 351 | WP_032610485.1 | hypothetical protein | - |
M5S84_RS24125 (M5S84_24125) | 252602..252808 | + | 207 | WP_044255297.1 | hypothetical protein | - |
M5S84_RS24130 (M5S84_24130) | 253042..253200 | - | 159 | WP_064758473.1 | type I toxin-antitoxin system Hok family toxin | - |
M5S84_RS24135 (M5S84_24135) | 253271..253558 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
M5S84_RS24140 (M5S84_24140) | 253558..253797 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
M5S84_RS24145 (M5S84_24145) | 253822..253926 | + | 105 | Protein_279 | protein YdfV | - |
M5S84_RS24150 (M5S84_24150) | 254060..254983 | - | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
M5S84_RS24155 (M5S84_24155) | 255183..255755 | - | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
M5S84_RS24160 (M5S84_24160) | 256231..257469 | - | 1239 | WP_259409756.1 | IS110 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaSHV-12 / ant(2'')-Ia / catB3 / qacE / sul1 / qnrB17 | vipA/tssB / vipB/tssC | 1..398127 | 398127 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T256176 WP_000323025.1 NZ_CP103684:c253558-253271 [Enterobacter hormaechei]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|