Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4674661..4675277 | Replicon | chromosome |
Accession | NZ_CP103683 | ||
Organism | Enterobacter hormaechei strain ST90 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M5S84_RS22335 | Protein ID | WP_077266491.1 |
Coordinates | 4674661..4675032 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
Locus tag | M5S84_RS22340 | Protein ID | WP_015569912.1 |
Coordinates | 4675035..4675277 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S84_RS22320 (M5S84_22320) | 4672161..4673063 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
M5S84_RS22325 (M5S84_22325) | 4673060..4673695 | + | 636 | WP_015569914.1 | formate dehydrogenase cytochrome b556 subunit | - |
M5S84_RS22330 (M5S84_22330) | 4673692..4674621 | + | 930 | WP_006808712.1 | formate dehydrogenase accessory protein FdhE | - |
M5S84_RS22335 (M5S84_22335) | 4674661..4675032 | - | 372 | WP_077266491.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M5S84_RS22340 (M5S84_22340) | 4675035..4675277 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
M5S84_RS22345 (M5S84_22345) | 4675476..4676396 | + | 921 | WP_063847977.1 | alpha/beta hydrolase | - |
M5S84_RS22350 (M5S84_22350) | 4676405..4677346 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
M5S84_RS22355 (M5S84_22355) | 4677391..4677828 | - | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
M5S84_RS22360 (M5S84_22360) | 4677825..4678706 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
M5S84_RS22365 (M5S84_22365) | 4678700..4679299 | - | 600 | WP_003861947.1 | glucose-1-phosphatase | - |
M5S84_RS22370 (M5S84_22370) | 4679418..4680218 | - | 801 | WP_003861944.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13723.85 Da Isoelectric Point: 6.4882
>T256175 WP_077266491.1 NZ_CP103683:c4675032-4674661 [Enterobacter hormaechei]
MEHMAVFDTNILIDLFNNRVEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRVEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|