Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 4549156..4549760 | Replicon | chromosome |
| Accession | NZ_CP103683 | ||
| Organism | Enterobacter hormaechei strain ST90 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2J0PXG2 |
| Locus tag | M5S84_RS21770 | Protein ID | WP_071788668.1 |
| Coordinates | 4549575..4549760 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A2G4ZRB5 |
| Locus tag | M5S84_RS21765 | Protein ID | WP_023295606.1 |
| Coordinates | 4549156..4549560 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S84_RS21750 (M5S84_21750) | 4544696..4545514 | - | 819 | WP_033488031.1 | helix-turn-helix domain-containing protein | - |
| M5S84_RS21755 (M5S84_21755) | 4545740..4547140 | + | 1401 | WP_033488030.1 | MFS transporter | - |
| M5S84_RS21760 (M5S84_21760) | 4547151..4549100 | + | 1950 | WP_033488029.1 | glycoside hydrolase family 127 protein | - |
| M5S84_RS21765 (M5S84_21765) | 4549156..4549560 | - | 405 | WP_023295606.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| M5S84_RS21770 (M5S84_21770) | 4549575..4549760 | - | 186 | WP_071788668.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| M5S84_RS21775 (M5S84_21775) | 4550010..4551548 | - | 1539 | WP_033488028.1 | aldehyde dehydrogenase AldB | - |
| M5S84_RS21780 (M5S84_21780) | 4551715..4552599 | + | 885 | WP_003860164.1 | ROK family protein | - |
| M5S84_RS21785 (M5S84_21785) | 4552603..4554441 | - | 1839 | WP_058686522.1 | selenocysteine-specific translation elongation factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6822.05 Da Isoelectric Point: 11.5191
>T256174 WP_071788668.1 NZ_CP103683:c4549760-4549575 [Enterobacter hormaechei]
VKSADIIAVLVSHGWKCVRTKGSHHQFRHPVQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
VKSADIIAVLVSHGWKCVRTKGSHHQFRHPVQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
Download Length: 186 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14954.71 Da Isoelectric Point: 4.2329
>AT256174 WP_023295606.1 NZ_CP103683:c4549560-4549156 [Enterobacter hormaechei]
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHFEALFEMDEALPLPGSVEVHLENQPDDFTGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFGNRSAFLAEAARRVLP
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHFEALFEMDEALPLPGSVEVHLENQPDDFTGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFGNRSAFLAEAARRVLP
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J0PXG2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2G4ZRB5 |