Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4008614..4009401 Replicon chromosome
Accession NZ_CP103683
Organism Enterobacter hormaechei strain ST90

Toxin (Protein)


Gene name yeeV Uniprot ID A0A6L5EGB6
Locus tag M5S84_RS19135 Protein ID WP_032669201.1
Coordinates 4008614..4008991 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A6L5EE19
Locus tag M5S84_RS19140 Protein ID WP_023567998.1
Coordinates 4009042..4009401 (-) Length 120 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S84_RS19105 (M5S84_19105) 4004226..4006070 + 1845 WP_015571912.1 RNA polymerase sigma factor RpoD -
M5S84_RS19110 (M5S84_19110) 4006172..4006678 - 507 WP_017384024.1 G/U mismatch-specific DNA glycosylase -
M5S84_RS19120 (M5S84_19120) 4006981..4007829 - 849 WP_032669204.1 DUF4942 domain-containing protein -
M5S84_RS19125 (M5S84_19125) 4007893..4008096 - 204 WP_032669203.1 DUF957 domain-containing protein -
M5S84_RS19130 (M5S84_19130) 4008126..4008617 - 492 WP_032672023.1 DUF5983 family protein -
M5S84_RS19135 (M5S84_19135) 4008614..4008991 - 378 WP_032669201.1 TA system toxin CbtA family protein Toxin
M5S84_RS19140 (M5S84_19140) 4009042..4009401 - 360 WP_023567998.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5S84_RS19145 (M5S84_19145) 4009425..4009646 - 222 WP_023567997.1 DUF987 domain-containing protein -
M5S84_RS19150 (M5S84_19150) 4009667..4010146 - 480 WP_032669200.1 DNA repair protein RadC -
M5S84_RS19155 (M5S84_19155) 4010158..4010601 - 444 WP_032669199.1 antirestriction protein -
M5S84_RS19160 (M5S84_19160) 4010632..4011453 - 822 WP_032669198.1 DUF932 domain-containing protein -
M5S84_RS19165 (M5S84_19165) 4011552..4011783 - 232 Protein_3745 DUF905 domain-containing protein -
M5S84_RS19170 (M5S84_19170) 4011855..4012304 - 450 WP_032669197.1 IrmA family protein -
M5S84_RS19175 (M5S84_19175) 4012301..4012756 - 456 WP_000754598.1 hypothetical protein -
M5S84_RS19180 (M5S84_19180) 4012795..4013430 - 636 WP_020837117.1 hypothetical protein -
M5S84_RS19185 (M5S84_19185) 4013427..4014140 - 714 WP_032669194.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(15-114)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14157.93 Da        Isoelectric Point: 6.2236

>T256173 WP_032669201.1 NZ_CP103683:c4008991-4008614 [Enterobacter hormaechei]
MQTQPLSSTQEATPRPSPVEIWQRLLSHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRTDRRGF
NAETQSPLLSSIDILRARKATGLMTRNDYRTVTDITTGKYREVQP

Download         Length: 378 bp

Antitoxin


Download         Length: 120 a.a.        Molecular weight: 13192.04 Da        Isoelectric Point: 6.3122

>AT256173 WP_023567998.1 NZ_CP103683:c4009401-4009042 [Enterobacter hormaechei]
MSNEIPTVNHDITEPWWGLKRSITPCFGARLVQAGNRLHYLADRANITGQFSDADLRYLDQAFPLLLKQLELMLTSGELN
PCHQHCVTLYAKGLTCEADSLGSHGYVYLAIYPTPAATA

Download         Length: 360 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6L5EGB6

Antitoxin

Source ID Structure
AlphaFold DB A0A6L5EE19

References