Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1156145..1156765 | Replicon | chromosome |
Accession | NZ_CP103683 | ||
Organism | Enterobacter hormaechei strain ST90 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A837FFM2 |
Locus tag | M5S84_RS05490 | Protein ID | WP_015571250.1 |
Coordinates | 1156145..1156363 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | F5RUW7 |
Locus tag | M5S84_RS05495 | Protein ID | WP_006809850.1 |
Coordinates | 1156391..1156765 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S84_RS05460 (M5S84_05460) | 1152157..1152417 | + | 261 | WP_015571255.1 | type B 50S ribosomal protein L31 | - |
M5S84_RS05465 (M5S84_05465) | 1152420..1152560 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
M5S84_RS05470 (M5S84_05470) | 1152557..1153267 | - | 711 | WP_033486653.1 | GNAT family protein | - |
M5S84_RS05475 (M5S84_05475) | 1153369..1154829 | + | 1461 | WP_033486652.1 | PLP-dependent aminotransferase family protein | - |
M5S84_RS05480 (M5S84_05480) | 1154801..1155268 | - | 468 | WP_023296041.1 | YlaC family protein | - |
M5S84_RS05485 (M5S84_05485) | 1155385..1155936 | - | 552 | WP_015571251.1 | maltose O-acetyltransferase | - |
M5S84_RS05490 (M5S84_05490) | 1156145..1156363 | - | 219 | WP_015571250.1 | HHA domain-containing protein | Toxin |
M5S84_RS05495 (M5S84_05495) | 1156391..1156765 | - | 375 | WP_006809850.1 | Hha toxicity modulator TomB | Antitoxin |
M5S84_RS05500 (M5S84_05500) | 1157276..1160422 | - | 3147 | WP_033486650.1 | multidrug efflux RND transporter permease subunit AcrB | - |
M5S84_RS05505 (M5S84_05505) | 1160445..1161638 | - | 1194 | WP_017694395.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8583.95 Da Isoelectric Point: 8.9008
>T256162 WP_015571250.1 NZ_CP103683:c1156363-1156145 [Enterobacter hormaechei]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14497.28 Da Isoelectric Point: 4.8989
>AT256162 WP_006809850.1 NZ_CP103683:c1156765-1156391 [Enterobacter hormaechei]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FFM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FGN8 |