Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 644221..644797 | Replicon | chromosome |
Accession | NZ_CP103683 | ||
Organism | Enterobacter hormaechei strain ST90 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | A0A800YKM1 |
Locus tag | M5S84_RS03075 | Protein ID | WP_015572580.1 |
Coordinates | 644221..644508 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A801DSF4 |
Locus tag | M5S84_RS03080 | Protein ID | WP_017694570.1 |
Coordinates | 644495..644797 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S84_RS03050 (M5S84_03050) | 639314..640033 | + | 720 | WP_050515874.1 | winged helix-turn-helix domain-containing protein | - |
M5S84_RS03055 (M5S84_03055) | 640183..640653 | + | 471 | WP_033486706.1 | MarR family transcriptional regulator | - |
M5S84_RS03060 (M5S84_03060) | 640650..641717 | + | 1068 | WP_026080654.1 | HlyD family secretion protein | - |
M5S84_RS03065 (M5S84_03065) | 641707..642783 | + | 1077 | WP_015572578.1 | DUF2955 domain-containing protein | - |
M5S84_RS03070 (M5S84_03070) | 642780..644051 | - | 1272 | WP_033486707.1 | DUF445 domain-containing protein | - |
M5S84_RS03075 (M5S84_03075) | 644221..644508 | + | 288 | WP_015572580.1 | BrnT family toxin | Toxin |
M5S84_RS03080 (M5S84_03080) | 644495..644797 | + | 303 | WP_017694570.1 | BrnA antitoxin family protein | Antitoxin |
M5S84_RS03085 (M5S84_03085) | 644826..645464 | - | 639 | WP_033486708.1 | LysE family translocator | - |
M5S84_RS03090 (M5S84_03090) | 645503..646255 | - | 753 | WP_033486709.1 | AraC family transcriptional regulator | - |
M5S84_RS03095 (M5S84_03095) | 646409..647779 | + | 1371 | WP_033486710.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
M5S84_RS03100 (M5S84_03100) | 647955..648500 | - | 546 | WP_033486712.1 | YfaZ family outer membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11296.81 Da Isoelectric Point: 7.3587
>T256161 WP_015572580.1 NZ_CP103683:644221-644508 [Enterobacter hormaechei]
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|