Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 213891..214417 | Replicon | plasmid pMB4528_1 |
| Accession | NZ_CP103680 | ||
| Organism | Enterobacter hormaechei strain MB4528 Variant | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | M5T06_RS23830 | Protein ID | WP_000323025.1 |
| Coordinates | 214130..214417 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | M5T06_RS23825 | Protein ID | WP_000534858.1 |
| Coordinates | 213891..214130 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T06_RS23805 (M5T06_23805) | 210219..211457 | + | 1239 | WP_259409756.1 | IS110 family transposase | - |
| M5T06_RS23810 (M5T06_23810) | 211933..212505 | + | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
| M5T06_RS23815 (M5T06_23815) | 212705..213628 | + | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
| M5T06_RS23820 (M5T06_23820) | 213762..213866 | - | 105 | Protein_225 | protein YdfV | - |
| M5T06_RS23825 (M5T06_23825) | 213891..214130 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| M5T06_RS23830 (M5T06_23830) | 214130..214417 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| M5T06_RS23835 (M5T06_23835) | 214488..214646 | + | 159 | WP_064758473.1 | type I toxin-antitoxin system Hok family toxin | - |
| M5T06_RS23840 (M5T06_23840) | 214880..215086 | - | 207 | WP_044255297.1 | hypothetical protein | - |
| M5T06_RS23845 (M5T06_23845) | 215126..215476 | - | 351 | WP_032610485.1 | hypothetical protein | - |
| M5T06_RS23850 (M5T06_23850) | 215500..216069 | - | 570 | WP_032610483.1 | hypothetical protein | - |
| M5T06_RS23855 (M5T06_23855) | 216114..216446 | - | 333 | WP_032610481.1 | DUF5417 domain-containing protein | - |
| M5T06_RS23860 (M5T06_23860) | 216571..216819 | - | 249 | WP_050596976.1 | hypothetical protein | - |
| M5T06_RS23865 (M5T06_23865) | 216879..217433 | - | 555 | WP_015063016.1 | hypothetical protein | - |
| M5T06_RS23870 (M5T06_23870) | 217619..217900 | - | 282 | WP_032610524.1 | hypothetical protein | - |
| M5T06_RS23875 (M5T06_23875) | 217887..218018 | - | 132 | WP_255344485.1 | hypothetical protein | - |
| M5T06_RS23880 (M5T06_23880) | 218018..218434 | - | 417 | WP_032610480.1 | hypothetical protein | - |
| M5T06_RS23885 (M5T06_23885) | 218434..218688 | - | 255 | WP_032610479.1 | hypothetical protein | - |
| M5T06_RS23890 (M5T06_23890) | 218699..219082 | - | 384 | WP_050596975.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul1 / qnrB17 / qacE / catB3 / ant(2'')-Ia / blaSHV-12 | vipB/tssC / vipA/tssB | 1..361069 | 361069 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T256159 WP_000323025.1 NZ_CP103680:214130-214417 [Enterobacter hormaechei]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|