Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 193029..193930 | Replicon | plasmid pMB4528_1 |
| Accession | NZ_CP103680 | ||
| Organism | Enterobacter hormaechei strain MB4528 Variant | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A330G4J7 |
| Locus tag | M5T06_RS23675 | Protein ID | WP_022652120.1 |
| Coordinates | 193472..193930 (+) | Length | 153 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | M5T06_RS23670 | Protein ID | WP_022652121.1 |
| Coordinates | 193029..193475 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T06_RS23635 (M5T06_23635) | 188521..188898 | + | 378 | WP_015063074.1 | hypothetical protein | - |
| M5T06_RS23640 (M5T06_23640) | 189034..189468 | + | 435 | WP_015063073.1 | hypothetical protein | - |
| M5T06_RS23645 (M5T06_23645) | 189532..189789 | + | 258 | WP_022652126.1 | hypothetical protein | - |
| M5T06_RS23650 (M5T06_23650) | 189905..190540 | + | 636 | WP_022652125.1 | hypothetical protein | - |
| M5T06_RS23655 (M5T06_23655) | 190602..191213 | + | 612 | WP_022652124.1 | hypothetical protein | - |
| M5T06_RS23660 (M5T06_23660) | 191200..192468 | + | 1269 | WP_022652123.1 | DNA methyltransferase | - |
| M5T06_RS23665 (M5T06_23665) | 192644..192952 | + | 309 | WP_022652122.1 | hypothetical protein | - |
| M5T06_RS23670 (M5T06_23670) | 193029..193475 | + | 447 | WP_022652121.1 | DUF2384 domain-containing protein | Antitoxin |
| M5T06_RS23675 (M5T06_23675) | 193472..193930 | + | 459 | WP_022652120.1 | RES family NAD+ phosphorylase | Toxin |
| M5T06_RS23680 (M5T06_23680) | 193968..194198 | + | 231 | WP_022652119.1 | hypothetical protein | - |
| M5T06_RS23685 (M5T06_23685) | 194533..194865 | + | 333 | WP_259409755.1 | hypothetical protein | - |
| M5T06_RS23690 (M5T06_23690) | 194922..195185 | + | 264 | WP_032610382.1 | hypothetical protein | - |
| M5T06_RS23695 (M5T06_23695) | 195415..196221 | + | 807 | WP_015063028.1 | hypothetical protein | - |
| M5T06_RS23700 (M5T06_23700) | 196268..196714 | + | 447 | WP_015063027.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul1 / qnrB17 / qacE / catB3 / ant(2'')-Ia / blaSHV-12 | vipB/tssC / vipA/tssB | 1..361069 | 361069 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 16758.14 Da Isoelectric Point: 4.4843
>T256158 WP_022652120.1 NZ_CP103680:193472-193930 [Enterobacter hormaechei]
VILYRMTKTRYITTAWSGLGAKEAGGRWNSVGTALVYLSETASLTMLETLVHINAPQLLDAYTLLSIDVPDDQIQAFDLN
LLPPGWASEDAPAELALYGDNWAESGSSVALRIPSALSPVEFNYLLNPAHPAIFDLMKTVQKIPYQYDTRLK
VILYRMTKTRYITTAWSGLGAKEAGGRWNSVGTALVYLSETASLTMLETLVHINAPQLLDAYTLLSIDVPDDQIQAFDLN
LLPPGWASEDAPAELALYGDNWAESGSSVALRIPSALSPVEFNYLLNPAHPAIFDLMKTVQKIPYQYDTRLK
Download Length: 459 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16606.03 Da Isoelectric Point: 7.4048
>AT256158 WP_022652121.1 NZ_CP103680:193029-193475 [Enterobacter hormaechei]
MTMKVFSPDLSKMNPHGLWQVVGLDNDGIALMDKISHGLEGKVAHSISEWANITPSELRKMSGIPNTTFNRSVKARFTAD
QSERLVRIIRVIERAVELFEGDKEAAQKWMNEPNRGLSWKTPADVVSSETGALEVMRLITRIEHGVYS
MTMKVFSPDLSKMNPHGLWQVVGLDNDGIALMDKISHGLEGKVAHSISEWANITPSELRKMSGIPNTTFNRSVKARFTAD
QSERLVRIIRVIERAVELFEGDKEAAQKWMNEPNRGLSWKTPADVVSSETGALEVMRLITRIEHGVYS
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|