Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4673884..4674500 | Replicon | chromosome |
| Accession | NZ_CP103679 | ||
| Organism | Enterobacter hormaechei strain MB4528 Variant | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M5T06_RS22285 | Protein ID | WP_077266491.1 |
| Coordinates | 4673884..4674255 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
| Locus tag | M5T06_RS22290 | Protein ID | WP_015569912.1 |
| Coordinates | 4674258..4674500 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T06_RS22270 (M5T06_22270) | 4671384..4672286 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
| M5T06_RS22275 (M5T06_22275) | 4672283..4672918 | + | 636 | WP_015569914.1 | formate dehydrogenase cytochrome b556 subunit | - |
| M5T06_RS22280 (M5T06_22280) | 4672915..4673844 | + | 930 | WP_006808712.1 | formate dehydrogenase accessory protein FdhE | - |
| M5T06_RS22285 (M5T06_22285) | 4673884..4674255 | - | 372 | WP_077266491.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M5T06_RS22290 (M5T06_22290) | 4674258..4674500 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| M5T06_RS22295 (M5T06_22295) | 4674699..4675619 | + | 921 | WP_063847977.1 | alpha/beta hydrolase | - |
| M5T06_RS22300 (M5T06_22300) | 4675628..4676569 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
| M5T06_RS22305 (M5T06_22305) | 4676614..4677051 | - | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
| M5T06_RS22310 (M5T06_22310) | 4677048..4677929 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
| M5T06_RS22315 (M5T06_22315) | 4677923..4678522 | - | 600 | WP_003861947.1 | glucose-1-phosphatase | - |
| M5T06_RS22320 (M5T06_22320) | 4678641..4679441 | - | 801 | WP_003861944.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13723.85 Da Isoelectric Point: 6.4882
>T256157 WP_077266491.1 NZ_CP103679:c4674255-4673884 [Enterobacter hormaechei]
MEHMAVFDTNILIDLFNNRVEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRVEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|