Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 4548379..4548983 | Replicon | chromosome |
| Accession | NZ_CP103679 | ||
| Organism | Enterobacter hormaechei strain MB4528 Variant | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2J0PXG2 |
| Locus tag | M5T06_RS21720 | Protein ID | WP_071788668.1 |
| Coordinates | 4548798..4548983 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A2G4ZRB5 |
| Locus tag | M5T06_RS21715 | Protein ID | WP_023295606.1 |
| Coordinates | 4548379..4548783 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T06_RS21700 (M5T06_21700) | 4543919..4544737 | - | 819 | WP_033488031.1 | helix-turn-helix domain-containing protein | - |
| M5T06_RS21705 (M5T06_21705) | 4544963..4546363 | + | 1401 | WP_033488030.1 | MFS transporter | - |
| M5T06_RS21710 (M5T06_21710) | 4546374..4548323 | + | 1950 | WP_033488029.1 | glycoside hydrolase family 127 protein | - |
| M5T06_RS21715 (M5T06_21715) | 4548379..4548783 | - | 405 | WP_023295606.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| M5T06_RS21720 (M5T06_21720) | 4548798..4548983 | - | 186 | WP_071788668.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| M5T06_RS21725 (M5T06_21725) | 4549233..4550771 | - | 1539 | WP_033488028.1 | aldehyde dehydrogenase AldB | - |
| M5T06_RS21730 (M5T06_21730) | 4550938..4551822 | + | 885 | WP_003860164.1 | ROK family protein | - |
| M5T06_RS21735 (M5T06_21735) | 4551826..4553664 | - | 1839 | WP_058686522.1 | selenocysteine-specific translation elongation factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6822.05 Da Isoelectric Point: 11.5191
>T256156 WP_071788668.1 NZ_CP103679:c4548983-4548798 [Enterobacter hormaechei]
VKSADIIAVLVSHGWKCVRTKGSHHQFRHPVQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
VKSADIIAVLVSHGWKCVRTKGSHHQFRHPVQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
Download Length: 186 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14954.71 Da Isoelectric Point: 4.2329
>AT256156 WP_023295606.1 NZ_CP103679:c4548783-4548379 [Enterobacter hormaechei]
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHFEALFEMDEALPLPGSVEVHLENQPDDFTGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFGNRSAFLAEAARRVLP
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHFEALFEMDEALPLPGSVEVHLENQPDDFTGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFGNRSAFLAEAARRVLP
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J0PXG2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2G4ZRB5 |