Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4007837..4008624 Replicon chromosome
Accession NZ_CP103679
Organism Enterobacter hormaechei strain MB4528 Variant

Toxin (Protein)


Gene name yeeV Uniprot ID A0A6L5EGB6
Locus tag M5T06_RS19085 Protein ID WP_032669201.1
Coordinates 4007837..4008214 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A6L5EE19
Locus tag M5T06_RS19090 Protein ID WP_023567998.1
Coordinates 4008265..4008624 (-) Length 120 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T06_RS19055 (M5T06_19055) 4003449..4005293 + 1845 WP_015571912.1 RNA polymerase sigma factor RpoD -
M5T06_RS19060 (M5T06_19060) 4005395..4005901 - 507 WP_017384024.1 G/U mismatch-specific DNA glycosylase -
M5T06_RS19070 (M5T06_19070) 4006204..4007052 - 849 WP_032669204.1 DUF4942 domain-containing protein -
M5T06_RS19075 (M5T06_19075) 4007116..4007319 - 204 WP_032669203.1 DUF957 domain-containing protein -
M5T06_RS19080 (M5T06_19080) 4007349..4007840 - 492 WP_032672023.1 DUF5983 family protein -
M5T06_RS19085 (M5T06_19085) 4007837..4008214 - 378 WP_032669201.1 TA system toxin CbtA family protein Toxin
M5T06_RS19090 (M5T06_19090) 4008265..4008624 - 360 WP_023567998.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5T06_RS19095 (M5T06_19095) 4008648..4008869 - 222 WP_023567997.1 DUF987 domain-containing protein -
M5T06_RS19100 (M5T06_19100) 4008890..4009369 - 480 WP_032669200.1 DNA repair protein RadC -
M5T06_RS19105 (M5T06_19105) 4009381..4009824 - 444 WP_032669199.1 antirestriction protein -
M5T06_RS19110 (M5T06_19110) 4009855..4010676 - 822 WP_032669198.1 DUF932 domain-containing protein -
M5T06_RS19115 (M5T06_19115) 4010775..4011006 - 232 Protein_3735 DUF905 domain-containing protein -
M5T06_RS19120 (M5T06_19120) 4011078..4011527 - 450 WP_032669197.1 IrmA family protein -
M5T06_RS19125 (M5T06_19125) 4011524..4011979 - 456 WP_000754598.1 hypothetical protein -
M5T06_RS19130 (M5T06_19130) 4012018..4012653 - 636 WP_020837117.1 hypothetical protein -
M5T06_RS19135 (M5T06_19135) 4012650..4013363 - 714 WP_032669194.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(15-114)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14157.93 Da        Isoelectric Point: 6.2236

>T256155 WP_032669201.1 NZ_CP103679:c4008214-4007837 [Enterobacter hormaechei]
MQTQPLSSTQEATPRPSPVEIWQRLLSHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRTDRRGF
NAETQSPLLSSIDILRARKATGLMTRNDYRTVTDITTGKYREVQP

Download         Length: 378 bp

Antitoxin


Download         Length: 120 a.a.        Molecular weight: 13192.04 Da        Isoelectric Point: 6.3122

>AT256155 WP_023567998.1 NZ_CP103679:c4008624-4008265 [Enterobacter hormaechei]
MSNEIPTVNHDITEPWWGLKRSITPCFGARLVQAGNRLHYLADRANITGQFSDADLRYLDQAFPLLLKQLELMLTSGELN
PCHQHCVTLYAKGLTCEADSLGSHGYVYLAIYPTPAATA

Download         Length: 360 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6L5EGB6

Antitoxin

Source ID Structure
AlphaFold DB A0A6L5EE19

References