Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2319242..2319981 | Replicon | chromosome |
| Accession | NZ_CP103679 | ||
| Organism | Enterobacter hormaechei strain MB4528 Variant | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | M5T06_RS11045 | Protein ID | WP_045339804.1 |
| Coordinates | 2319242..2319727 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A837FCR9 |
| Locus tag | M5T06_RS11050 | Protein ID | WP_003857131.1 |
| Coordinates | 2319715..2319981 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T06_RS11015 (M5T06_11015) | 2314295..2315587 | + | 1293 | WP_032671140.1 | glycosyl hydrolase family 28 protein | - |
| M5T06_RS11020 (M5T06_11020) | 2315656..2316201 | + | 546 | WP_032671141.1 | NUDIX hydrolase | - |
| M5T06_RS11025 (M5T06_11025) | 2316385..2317020 | - | 636 | WP_063847894.1 | DUF421 domain-containing protein | - |
| M5T06_RS11030 (M5T06_11030) | 2317030..2317254 | - | 225 | Protein_2152 | DUF3290 family protein | - |
| M5T06_RS11035 (M5T06_11035) | 2317641..2318606 | + | 966 | WP_058689390.1 | hypothetical protein | - |
| M5T06_RS11040 (M5T06_11040) | 2318622..2319191 | + | 570 | WP_063847895.1 | hypothetical protein | - |
| M5T06_RS11045 (M5T06_11045) | 2319242..2319727 | - | 486 | WP_045339804.1 | GNAT family N-acetyltransferase | Toxin |
| M5T06_RS11050 (M5T06_11050) | 2319715..2319981 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
| M5T06_RS11055 (M5T06_11055) | 2320045..2320974 | - | 930 | WP_063847896.1 | LysR family transcriptional regulator | - |
| M5T06_RS11060 (M5T06_11060) | 2321104..2322486 | + | 1383 | WP_033487775.1 | MFS transporter | - |
| M5T06_RS11065 (M5T06_11065) | 2322508..2323503 | - | 996 | WP_033487776.1 | DUF2891 domain-containing protein | - |
| M5T06_RS11070 (M5T06_11070) | 2323513..2324499 | - | 987 | WP_033487777.1 | DUF979 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17558.27 Da Isoelectric Point: 9.9658
>T256147 WP_045339804.1 NZ_CP103679:c2319727-2319242 [Enterobacter hormaechei]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAMMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAMMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|