Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 4661843..4662546 | Replicon | chromosome |
Accession | NZ_CP103676 | ||
Organism | Klebsiella pneumoniae strain 2946 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | A0A939NMR5 |
Locus tag | M5S99_RS22655 | Protein ID | WP_071994632.1 |
Coordinates | 4661843..4662184 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A939NIK9 |
Locus tag | M5S99_RS22660 | Protein ID | WP_032434296.1 |
Coordinates | 4662205..4662546 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S99_RS22645 (4658158) | 4658158..4659027 | + | 870 | WP_023317468.1 | HNH endonuclease | - |
M5S99_RS22650 (4659618) | 4659618..4661651 | + | 2034 | WP_050598589.1 | hypothetical protein | - |
M5S99_RS22655 (4661843) | 4661843..4662184 | - | 342 | WP_071994632.1 | TA system toxin CbtA family protein | Toxin |
M5S99_RS22660 (4662205) | 4662205..4662546 | - | 342 | WP_032434296.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M5S99_RS22665 (4662557) | 4662557..4663099 | - | 543 | WP_032434298.1 | DNA repair protein RadC | - |
M5S99_RS22670 (4663112) | 4663112..4663552 | - | 441 | WP_032434300.1 | antirestriction protein | - |
M5S99_RS22675 (4663583) | 4663583..4664404 | - | 822 | WP_032434301.1 | DUF932 domain-containing protein | - |
M5S99_RS22680 (4664524) | 4664524..4664997 | - | 474 | WP_032434303.1 | hypothetical protein | - |
M5S99_RS22685 (4665069) | 4665069..4665521 | - | 453 | WP_032410767.1 | hypothetical protein | - |
M5S99_RS22690 (4665557) | 4665557..4666273 | - | 717 | WP_032434305.1 | WYL domain-containing protein | - |
M5S99_RS22695 (4666517) | 4666517..4667391 | - | 875 | Protein_4447 | GTPase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4650140..4695813 | 45673 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12789.77 Da Isoelectric Point: 9.6552
>T256138 WP_071994632.1 NZ_CP103676:c4662184-4661843 [Klebsiella pneumoniae]
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|