Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3989471..3990090 | Replicon | chromosome |
| Accession | NZ_CP103676 | ||
| Organism | Klebsiella pneumoniae strain 2946 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | M5S99_RS19440 | Protein ID | WP_002892050.1 |
| Coordinates | 3989872..3990090 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | M5S99_RS19435 | Protein ID | WP_002892066.1 |
| Coordinates | 3989471..3989845 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S99_RS19425 (3984623) | 3984623..3985816 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M5S99_RS19430 (3985839) | 3985839..3988985 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| M5S99_RS19435 (3989471) | 3989471..3989845 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| M5S99_RS19440 (3989872) | 3989872..3990090 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| M5S99_RS19445 (3990249) | 3990249..3990815 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| M5S99_RS19450 (3990787) | 3990787..3990927 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| M5S99_RS19455 (3990948) | 3990948..3991418 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| M5S99_RS19460 (3991393) | 3991393..3992844 | - | 1452 | WP_032435563.1 | PLP-dependent aminotransferase family protein | - |
| M5S99_RS19465 (3992945) | 3992945..3993643 | + | 699 | WP_032435564.1 | GNAT family protein | - |
| M5S99_RS19470 (3993640) | 3993640..3993780 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| M5S99_RS19475 (3993780) | 3993780..3994043 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T256136 WP_002892050.1 NZ_CP103676:3989872-3990090 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT256136 WP_002892066.1 NZ_CP103676:3989471-3989845 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |