Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3989471..3990090 Replicon chromosome
Accession NZ_CP103676
Organism Klebsiella pneumoniae strain 2946

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M5S99_RS19440 Protein ID WP_002892050.1
Coordinates 3989872..3990090 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M5S99_RS19435 Protein ID WP_002892066.1
Coordinates 3989471..3989845 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S99_RS19425 (3984623) 3984623..3985816 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M5S99_RS19430 (3985839) 3985839..3988985 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M5S99_RS19435 (3989471) 3989471..3989845 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M5S99_RS19440 (3989872) 3989872..3990090 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M5S99_RS19445 (3990249) 3990249..3990815 + 567 WP_002892030.1 maltose O-acetyltransferase -
M5S99_RS19450 (3990787) 3990787..3990927 - 141 WP_004147370.1 hypothetical protein -
M5S99_RS19455 (3990948) 3990948..3991418 + 471 WP_002892026.1 YlaC family protein -
M5S99_RS19460 (3991393) 3991393..3992844 - 1452 WP_032435563.1 PLP-dependent aminotransferase family protein -
M5S99_RS19465 (3992945) 3992945..3993643 + 699 WP_032435564.1 GNAT family protein -
M5S99_RS19470 (3993640) 3993640..3993780 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M5S99_RS19475 (3993780) 3993780..3994043 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T256136 WP_002892050.1 NZ_CP103676:3989872-3990090 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT256136 WP_002892066.1 NZ_CP103676:3989471-3989845 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References