Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 1862..2397 | Replicon | plasmid pMB4861_1 |
| Accession | NZ_CP103675 | ||
| Organism | Enterobacter hormaechei strain 1074 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | M5T14_RS22245 | Protein ID | WP_259385504.1 |
| Coordinates | 2110..2397 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | M5T14_RS22240 | Protein ID | WP_235423158.1 |
| Coordinates | 1862..2113 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T14_RS22235 (M5T14_22235) | 1282..1655 | - | 374 | Protein_1 | site-specific integrase | - |
| M5T14_RS22240 (M5T14_22240) | 1862..2113 | + | 252 | WP_235423158.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M5T14_RS22245 (M5T14_22245) | 2110..2397 | + | 288 | WP_259385504.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5T14_RS22250 (M5T14_22250) | 2664..4574 | + | 1911 | WP_259385505.1 | NACHT domain-containing protein | - |
| M5T14_RS22255 (M5T14_22255) | 4742..5731 | + | 990 | WP_259385506.1 | tyrosine-type recombinase/integrase | - |
| M5T14_RS22260 (M5T14_22260) | 5895..6038 | - | 144 | Protein_6 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
| M5T14_RS22265 (M5T14_22265) | 6089..6328 | - | 240 | WP_259385507.1 | type II toxin-antitoxin system antitoxin RelB | - |
| M5T14_RS22270 (M5T14_22270) | 6646..6963 | + | 318 | WP_259385508.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..86737 | 86737 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11002.00 Da Isoelectric Point: 10.2278
>T256126 WP_259385504.1 NZ_CP103675:2110-2397 [Enterobacter hormaechei]
MTYTVKFRDDALKEWHKLDKAIQQQFAKKLKKCCGNPHIPSAKLCGIKDCYKIKLRASGFRLVYQVIDDQLIIAVVAVGK
RERSDVYNLASERMR
MTYTVKFRDDALKEWHKLDKAIQQQFAKKLKKCCGNPHIPSAKLCGIKDCYKIKLRASGFRLVYQVIDDQLIIAVVAVGK
RERSDVYNLASERMR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|