Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4589063..4589679 | Replicon | chromosome |
Accession | NZ_CP103674 | ||
Organism | Enterobacter hormaechei strain 1074 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M5T14_RS21820 | Protein ID | WP_045327153.1 |
Coordinates | 4589063..4589434 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
Locus tag | M5T14_RS21825 | Protein ID | WP_015569912.1 |
Coordinates | 4589437..4589679 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T14_RS21805 (M5T14_21805) | 4586563..4587465 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
M5T14_RS21810 (M5T14_21810) | 4587462..4588097 | + | 636 | WP_003861958.1 | formate dehydrogenase cytochrome b556 subunit | - |
M5T14_RS21815 (M5T14_21815) | 4588094..4589023 | + | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
M5T14_RS21820 (M5T14_21820) | 4589063..4589434 | - | 372 | WP_045327153.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M5T14_RS21825 (M5T14_21825) | 4589437..4589679 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
M5T14_RS21830 (M5T14_21830) | 4589878..4590798 | + | 921 | WP_045327152.1 | alpha/beta hydrolase | - |
M5T14_RS21835 (M5T14_21835) | 4590807..4591748 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
M5T14_RS21840 (M5T14_21840) | 4591793..4592230 | - | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
M5T14_RS21845 (M5T14_21845) | 4592227..4593108 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
M5T14_RS21850 (M5T14_21850) | 4593102..4593701 | - | 600 | WP_003861947.1 | glucose-1-phosphatase | - |
M5T14_RS21855 (M5T14_21855) | 4593820..4594620 | - | 801 | WP_003861944.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13697.77 Da Isoelectric Point: 6.4882
>T256125 WP_045327153.1 NZ_CP103674:c4589434-4589063 [Enterobacter hormaechei]
MEHMAVFDTNILIDLFNNRVEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVSLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRVEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVSLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|