Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3796113..3796770 | Replicon | chromosome |
| Accession | NZ_CP103674 | ||
| Organism | Enterobacter hormaechei strain 1074 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A179PSF7 |
| Locus tag | M5T14_RS18040 | Protein ID | WP_017382887.1 |
| Coordinates | 3796113..3796523 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | G8LDB7 |
| Locus tag | M5T14_RS18045 | Protein ID | WP_003863437.1 |
| Coordinates | 3796504..3796770 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T14_RS18020 (M5T14_18020) | 3792111..3793844 | - | 1734 | WP_032649421.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| M5T14_RS18025 (M5T14_18025) | 3793850..3794563 | - | 714 | WP_015571792.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M5T14_RS18030 (M5T14_18030) | 3794592..3795488 | - | 897 | WP_003863442.1 | site-specific tyrosine recombinase XerD | - |
| M5T14_RS18035 (M5T14_18035) | 3795590..3796111 | + | 522 | WP_015571793.1 | flavodoxin FldB | - |
| M5T14_RS18040 (M5T14_18040) | 3796113..3796523 | - | 411 | WP_017382887.1 | protein YgfX | Toxin |
| M5T14_RS18045 (M5T14_18045) | 3796504..3796770 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
| M5T14_RS18050 (M5T14_18050) | 3797065..3798045 | + | 981 | WP_022649306.1 | tRNA-modifying protein YgfZ | - |
| M5T14_RS18055 (M5T14_18055) | 3798157..3798816 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
| M5T14_RS18060 (M5T14_18060) | 3799083..3799814 | + | 732 | WP_015571796.1 | MurR/RpiR family transcriptional regulator | - |
| M5T14_RS18065 (M5T14_18065) | 3799931..3801364 | + | 1434 | WP_017382891.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16321.21 Da Isoelectric Point: 11.4775
>T256124 WP_017382887.1 NZ_CP103674:c3796523-3796113 [Enterobacter hormaechei]
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A179PSF7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837F8P5 |