Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2271308..2272047 | Replicon | chromosome |
Accession | NZ_CP103674 | ||
Organism | Enterobacter hormaechei strain 1074 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A3L9PBP9 |
Locus tag | M5T14_RS10765 | Protein ID | WP_003857133.1 |
Coordinates | 2271308..2271793 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A837FCR9 |
Locus tag | M5T14_RS10770 | Protein ID | WP_003857131.1 |
Coordinates | 2271781..2272047 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T14_RS10740 (M5T14_10740) | 2266848..2267606 | - | 759 | WP_023296628.1 | trans-aconitate 2-methyltransferase | - |
M5T14_RS10745 (M5T14_10745) | 2267691..2268275 | - | 585 | WP_017382349.1 | GDP-mannose pyrophosphatase nudK | - |
M5T14_RS10750 (M5T14_10750) | 2268362..2269120 | + | 759 | WP_047719552.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
M5T14_RS10755 (M5T14_10755) | 2269225..2270517 | + | 1293 | WP_259385434.1 | glycosyl hydrolase family 28 protein | - |
M5T14_RS10760 (M5T14_10760) | 2270517..2271131 | + | 615 | WP_080346687.1 | NUDIX hydrolase | - |
M5T14_RS10765 (M5T14_10765) | 2271308..2271793 | - | 486 | WP_003857133.1 | GNAT family N-acetyltransferase | Toxin |
M5T14_RS10770 (M5T14_10770) | 2271781..2272047 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
M5T14_RS10775 (M5T14_10775) | 2272111..2273040 | - | 930 | WP_259385435.1 | LysR family transcriptional regulator | - |
M5T14_RS10780 (M5T14_10780) | 2273170..2274558 | + | 1389 | WP_259385436.1 | MFS transporter | - |
M5T14_RS10785 (M5T14_10785) | 2274580..2275575 | - | 996 | WP_259385437.1 | DUF2891 domain-containing protein | - |
M5T14_RS10790 (M5T14_10790) | 2275585..2276571 | - | 987 | WP_023296632.1 | DUF979 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2258792..2272047 | 13255 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17540.23 Da Isoelectric Point: 9.9658
>T256117 WP_003857133.1 NZ_CP103674:c2271793-2271308 [Enterobacter hormaechei]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3L9PBP9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FCR9 |