Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1127535..1128155 | Replicon | chromosome |
| Accession | NZ_CP103674 | ||
| Organism | Enterobacter hormaechei strain 1074 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A837FFM2 |
| Locus tag | M5T14_RS05355 | Protein ID | WP_015571250.1 |
| Coordinates | 1127535..1127753 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | F5RUW7 |
| Locus tag | M5T14_RS05360 | Protein ID | WP_006809850.1 |
| Coordinates | 1127781..1128155 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T14_RS05325 (M5T14_05325) | 1123547..1123807 | + | 261 | WP_015571255.1 | type B 50S ribosomal protein L31 | - |
| M5T14_RS05330 (M5T14_05330) | 1123810..1123950 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| M5T14_RS05335 (M5T14_05335) | 1123947..1124657 | - | 711 | WP_032670463.1 | GNAT family protein | - |
| M5T14_RS05340 (M5T14_05340) | 1124759..1126219 | + | 1461 | WP_059294834.1 | PLP-dependent aminotransferase family protein | - |
| M5T14_RS05345 (M5T14_05345) | 1126191..1126658 | - | 468 | WP_017383209.1 | YlaC family protein | - |
| M5T14_RS05350 (M5T14_05350) | 1126775..1127326 | - | 552 | WP_017383210.1 | maltose O-acetyltransferase | - |
| M5T14_RS05355 (M5T14_05355) | 1127535..1127753 | - | 219 | WP_015571250.1 | HHA domain-containing protein | Toxin |
| M5T14_RS05360 (M5T14_05360) | 1127781..1128155 | - | 375 | WP_006809850.1 | Hha toxicity modulator TomB | Antitoxin |
| M5T14_RS05365 (M5T14_05365) | 1128666..1131812 | - | 3147 | WP_015571248.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| M5T14_RS05370 (M5T14_05370) | 1131835..1133028 | - | 1194 | WP_017694395.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8583.95 Da Isoelectric Point: 8.9008
>T256116 WP_015571250.1 NZ_CP103674:c1127753-1127535 [Enterobacter hormaechei]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14497.28 Da Isoelectric Point: 4.8989
>AT256116 WP_006809850.1 NZ_CP103674:c1128155-1127781 [Enterobacter hormaechei]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FFM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FGN8 |