Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4489438..4490033 | Replicon | chromosome |
Accession | NZ_CP103673 | ||
Organism | Escherichia coli strain 4069 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | A0A0V9NWK6 |
Locus tag | M4U10_RS21410 | Protein ID | WP_019842229.1 |
Coordinates | 4489438..4489788 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | L4JJX7 |
Locus tag | M4U10_RS21415 | Protein ID | WP_001223213.1 |
Coordinates | 4489782..4490033 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4U10_RS21390 (4484768) | 4484768..4485790 | - | 1023 | WP_001550507.1 | ABC transporter permease | - |
M4U10_RS21395 (4485804) | 4485804..4487306 | - | 1503 | WP_001550506.1 | sugar ABC transporter ATP-binding protein | - |
M4U10_RS21400 (4487438) | 4487438..4488394 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
M4U10_RS21405 (4488704) | 4488704..4489234 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
M4U10_RS21410 (4489438) | 4489438..4489788 | - | 351 | WP_019842229.1 | endoribonuclease toxin ChpB | Toxin |
M4U10_RS21415 (4489782) | 4489782..4490033 | - | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
M4U10_RS21420 (4490245) | 4490245..4490586 | - | 342 | WP_001550504.1 | gamma-glutamylcyclotransferase | - |
M4U10_RS21425 (4490589) | 4490589..4494368 | - | 3780 | WP_001550503.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12483.44 Da Isoelectric Point: 5.6097
>T256112 WP_019842229.1 NZ_CP103673:c4489788-4489438 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVWMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVWMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9NWK6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | L4JJX7 |