Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4124711..4125546 Replicon chromosome
Accession NZ_CP103673
Organism Escherichia coli strain 4069

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0A1A9A5
Locus tag M4U10_RS19650 Protein ID WP_001564063.1
Coordinates 4125169..4125546 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0A1AEL8
Locus tag M4U10_RS19645 Protein ID WP_038432125.1
Coordinates 4124711..4125079 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4U10_RS19610 (4120370) 4120370..4121050 + 681 WP_001278649.1 WYL domain-containing protein -
M4U10_RS19615 (4121201) 4121201..4121878 + 678 WP_001564058.1 hypothetical protein -
M4U10_RS19620 (4121884) 4121884..4122117 + 234 WP_001278293.1 DUF905 family protein -
M4U10_RS19625 (4122207) 4122207..4123025 + 819 WP_001175165.1 DUF932 domain-containing protein -
M4U10_RS19630 (4123291) 4123291..4123770 + 480 WP_001564060.1 antirestriction protein -
M4U10_RS19635 (4123786) 4123786..4124262 + 477 WP_021553055.1 RadC family protein -
M4U10_RS19640 (4124327) 4124327..4124548 + 222 WP_000692345.1 DUF987 domain-containing protein -
M4U10_RS19645 (4124711) 4124711..4125079 + 369 WP_038432125.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M4U10_RS19650 (4125169) 4125169..4125546 + 378 WP_001564063.1 TA system toxin CbtA family protein Toxin
M4U10_RS19655 (4125543) 4125543..4125692 + 150 Protein_3844 DUF5983 family protein -
M4U10_RS19660 (4125771) 4125771..4125965 + 195 WP_024181941.1 DUF957 domain-containing protein -
M4U10_RS19665 (4126050) 4126050..4126892 + 843 Protein_3846 DUF4942 domain-containing protein -
M4U10_RS19670 (4127234) 4127234..4127404 + 171 Protein_3847 IS110 family transposase -
M4U10_RS19675 (4128215) 4128215..4129198 + 984 WP_001361242.1 KpsF/GutQ family sugar-phosphate isomerase -
M4U10_RS19680 (4129270) 4129270..4130418 + 1149 WP_000905920.1 capsule polysaccharide export inner-membrane protein KpsE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - papX 4058108..4127019 68911
- flank IS/Tn - - 4127300..4127404 104


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14094.09 Da        Isoelectric Point: 7.8045

>T256110 WP_001564063.1 NZ_CP103673:4125169-4125546 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13569.31 Da        Isoelectric Point: 7.0369

>AT256110 WP_038432125.1 NZ_CP103673:4124711-4125079 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A1A9A5

Antitoxin

Source ID Structure
AlphaFold DB A0A0A1AEL8

References