Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4124711..4125546 | Replicon | chromosome |
| Accession | NZ_CP103673 | ||
| Organism | Escherichia coli strain 4069 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0A1A9A5 |
| Locus tag | M4U10_RS19650 | Protein ID | WP_001564063.1 |
| Coordinates | 4125169..4125546 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0A1AEL8 |
| Locus tag | M4U10_RS19645 | Protein ID | WP_038432125.1 |
| Coordinates | 4124711..4125079 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4U10_RS19610 (4120370) | 4120370..4121050 | + | 681 | WP_001278649.1 | WYL domain-containing protein | - |
| M4U10_RS19615 (4121201) | 4121201..4121878 | + | 678 | WP_001564058.1 | hypothetical protein | - |
| M4U10_RS19620 (4121884) | 4121884..4122117 | + | 234 | WP_001278293.1 | DUF905 family protein | - |
| M4U10_RS19625 (4122207) | 4122207..4123025 | + | 819 | WP_001175165.1 | DUF932 domain-containing protein | - |
| M4U10_RS19630 (4123291) | 4123291..4123770 | + | 480 | WP_001564060.1 | antirestriction protein | - |
| M4U10_RS19635 (4123786) | 4123786..4124262 | + | 477 | WP_021553055.1 | RadC family protein | - |
| M4U10_RS19640 (4124327) | 4124327..4124548 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| M4U10_RS19645 (4124711) | 4124711..4125079 | + | 369 | WP_038432125.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M4U10_RS19650 (4125169) | 4125169..4125546 | + | 378 | WP_001564063.1 | TA system toxin CbtA family protein | Toxin |
| M4U10_RS19655 (4125543) | 4125543..4125692 | + | 150 | Protein_3844 | DUF5983 family protein | - |
| M4U10_RS19660 (4125771) | 4125771..4125965 | + | 195 | WP_024181941.1 | DUF957 domain-containing protein | - |
| M4U10_RS19665 (4126050) | 4126050..4126892 | + | 843 | Protein_3846 | DUF4942 domain-containing protein | - |
| M4U10_RS19670 (4127234) | 4127234..4127404 | + | 171 | Protein_3847 | IS110 family transposase | - |
| M4U10_RS19675 (4128215) | 4128215..4129198 | + | 984 | WP_001361242.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| M4U10_RS19680 (4129270) | 4129270..4130418 | + | 1149 | WP_000905920.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | papX | 4058108..4127019 | 68911 | |
| - | flank | IS/Tn | - | - | 4127300..4127404 | 104 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14094.09 Da Isoelectric Point: 7.8045
>T256110 WP_001564063.1 NZ_CP103673:4125169-4125546 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13569.31 Da Isoelectric Point: 7.0369
>AT256110 WP_038432125.1 NZ_CP103673:4124711-4125079 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSGGYVYLAVYPTPETKK
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A1A9A5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A1AEL8 |