Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3988102..3988756 | Replicon | chromosome |
| Accession | NZ_CP103673 | ||
| Organism | Escherichia coli strain 4069 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1EEB2 |
| Locus tag | M4U10_RS18920 | Protein ID | WP_000244777.1 |
| Coordinates | 3988102..3988509 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | M4U10_RS18925 | Protein ID | WP_000354046.1 |
| Coordinates | 3988490..3988756 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4U10_RS18900 (3984059) | 3984059..3985792 | - | 1734 | WP_001564004.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| M4U10_RS18905 (3985798) | 3985798..3986508 | - | 711 | WP_001564005.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M4U10_RS18910 (3986533) | 3986533..3987429 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| M4U10_RS18915 (3987541) | 3987541..3988062 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| M4U10_RS18920 (3988102) | 3988102..3988509 | - | 408 | WP_000244777.1 | protein YgfX | Toxin |
| M4U10_RS18925 (3988490) | 3988490..3988756 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| M4U10_RS18930 (3988999) | 3988999..3989979 | + | 981 | WP_000886083.1 | tRNA-modifying protein YgfZ | - |
| M4U10_RS18935 (3990175) | 3990175..3990834 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| M4U10_RS18940 (3990998) | 3990998..3991309 | - | 312 | WP_001182966.1 | N(4)-acetylcytidine aminohydrolase | - |
| M4U10_RS18945 (3991354) | 3991354..3992787 | + | 1434 | WP_001336277.1 | 6-phospho-beta-glucosidase BglA | - |
| M4U10_RS18950 (3992844) | 3992844..3993587 | - | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T256109 WP_000244777.1 NZ_CP103673:c3988509-3988102 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LFV7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |