Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 3842152..3842735 | Replicon | chromosome |
| Accession | NZ_CP103673 | ||
| Organism | Escherichia coli strain 4069 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S1EZP4 |
| Locus tag | M4U10_RS18260 | Protein ID | WP_000254738.1 |
| Coordinates | 3842152..3842487 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | M4U10_RS18265 | Protein ID | WP_000581937.1 |
| Coordinates | 3842487..3842735 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4U10_RS18245 (3838038) | 3838038..3839336 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
| M4U10_RS18250 (3839424) | 3839424..3841061 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| M4U10_RS18255 (3841289) | 3841289..3842080 | - | 792 | WP_001071643.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| M4U10_RS18260 (3842152) | 3842152..3842487 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
| M4U10_RS18265 (3842487) | 3842487..3842735 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| M4U10_RS18270 (3842813) | 3842813..3845047 | - | 2235 | WP_001551562.1 | GTP diphosphokinase | - |
| M4U10_RS18275 (3845095) | 3845095..3846396 | - | 1302 | WP_001551563.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T256108 WP_000254738.1 NZ_CP103673:c3842487-3842152 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|