Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 1785915..1786710 | Replicon | chromosome |
Accession | NZ_CP103673 | ||
Organism | Escherichia coli strain 4069 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | B7UP43 |
Locus tag | M4U10_RS08385 | Protein ID | WP_000854914.1 |
Coordinates | 1786336..1786710 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | B7UP42 |
Locus tag | M4U10_RS08380 | Protein ID | WP_001280955.1 |
Coordinates | 1785915..1786289 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4U10_RS08350 (1782713) | 1782713..1783168 | + | 456 | WP_000581506.1 | IrmA family protein | - |
M4U10_RS08355 (1783269) | 1783269..1783477 | + | 209 | Protein_1628 | DUF905 domain-containing protein | - |
M4U10_RS08360 (1783578) | 1783578..1784399 | + | 822 | WP_001761104.1 | DUF932 domain-containing protein | - |
M4U10_RS08365 (1784491) | 1784491..1784976 | + | 486 | WP_000214307.1 | antirestriction protein | - |
M4U10_RS08370 (1784992) | 1784992..1785468 | + | 477 | WP_001186726.1 | RadC family protein | - |
M4U10_RS08375 (1785531) | 1785531..1785752 | + | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
M4U10_RS08380 (1785915) | 1785915..1786289 | + | 375 | WP_001280955.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M4U10_RS08385 (1786336) | 1786336..1786710 | + | 375 | WP_000854914.1 | TA system toxin CbtA family protein | Toxin |
M4U10_RS08390 (1786707) | 1786707..1787198 | + | 492 | WP_000976857.1 | DUF5983 family protein | - |
M4U10_RS08395 (1787210) | 1787210..1787407 | + | 198 | WP_166465036.1 | DUF957 domain-containing protein | - |
M4U10_RS08400 (1787492) | 1787492..1788334 | + | 843 | WP_001280481.1 | DUF4942 domain-containing protein | - |
M4U10_RS08410 (1788825) | 1788825..1789043 | - | 219 | WP_001040187.1 | translation initiation factor IF-1 | - |
M4U10_RS08415 (1789328) | 1789328..1790032 | - | 705 | WP_001241678.1 | leucyl/phenylalanyl-tRNA--protein transferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14117.17 Da Isoelectric Point: 7.7761
>T256099 WP_000854914.1 NZ_CP103673:1786336-1786710 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13767.59 Da Isoelectric Point: 6.6248
>AT256099 WP_001280955.1 NZ_CP103673:1785915-1786289 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LXR5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9P0D0 |