Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 1663488..1664193 | Replicon | chromosome |
Accession | NZ_CP103673 | ||
Organism | Escherichia coli strain 4069 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | M4U10_RS07805 | Protein ID | WP_000539521.1 |
Coordinates | 1663807..1664193 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | M4U10_RS07800 | Protein ID | WP_001280945.1 |
Coordinates | 1663488..1663817 (-) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4U10_RS07785 (1658645) | 1658645..1659556 | + | 912 | Protein_1515 | glutathione ABC transporter permease GsiD | - |
M4U10_RS07790 (1659734) | 1659734..1662082 | + | 2349 | WP_001550886.1 | EAL domain-containing protein | - |
M4U10_RS07795 (1662090) | 1662090..1663418 | + | 1329 | WP_001550887.1 | GGDEF domain-containing protein | - |
M4U10_RS07800 (1663488) | 1663488..1663817 | - | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
M4U10_RS07805 (1663807) | 1663807..1664193 | - | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M4U10_RS07810 (1664419) | 1664419..1665744 | - | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
M4U10_RS07815 (1665957) | 1665957..1666340 | + | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
M4U10_RS07820 (1666451) | 1666451..1667566 | + | 1116 | WP_000555051.1 | aldose sugar dehydrogenase YliI | - |
M4U10_RS07825 (1667563) | 1667563..1668189 | - | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T256097 WP_000539521.1 NZ_CP103673:c1664193-1663807 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|